Os03t0254400-02

Locus

Os03g0254400

Description

Similar to patatin-like protein 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OspPLAIIIalpha, pPLAIIIalpha

Oryzabase Gene Name Synonym(s)

Patatin-related phospholipase A III alpha

Transcript Evidence

CT835191 (DDBJ, Best hit)

Protein Evidence

NP_001150435.1 (RefSeq)

Literature

Note

Manual Curation

Others

Oryzabase (19872)

Transcript

1088 bp

>Os03t0254400-02 Similar to patatin-like protein 3.
GAGAGAGAGAGAGAGAGAGGAAGACGACGACGACCTTTGTTGTTGTTTCCTTCTTTCTCT
TCTCTTCTCCTCATCCTCCTCTTTAGCTTCCTCTCGCGCTCGCCGTCTCTCTCTCTCTCT
CTCTATCGGGCGCGCGCCTTTCTGTGTTGGTCGTCTCTTTCCTCGCGTGCTCTGCCGCTG
CGCAAGAATCAAAAGGCGCCGGCCACTAGAGAGAGTGTGTGTTTGTGTGTGTGTGGCTTG
AGTTGAGAGTTGAGAGACCAATCGACCATCGGCTGTGATCTCAAAAGAGAGAGAGGGGCA
AAGCGAAGTGGGCAGACTTGGGCGGCAATCCTTGCGAATCATCAAGGGATTCTGTCTTTT
CTTTGGTGCGATTCGATTGTTTCTTTGTAGGGGGAAGGGAGAGAGGAGGGGGGGGGGGGG
TTTTGGCAATTGGCATGGAGGAGGCGGAGGAGATGCAGGTGGAGAGGATGCAGGAGGAGG
TGGAGGGAGGCGGCGCGGATACGGATAAGCTCAGCTACGAGATTTTCTCCATCCTCGAGA
GCAAGTTCCTGTTCGGGTACACGGACCCGCACCAGCTGTGGCTGCCCAAGGCGCCGGCGG
CGCAGGCGTCGGCGGCGACGGCCGTGCCGTCGGGGAAGGCGGCGCAGCGTGGGAAGGTGT
GCGcgccgccgccgcaatcacgcacgtgcttcacaacaagcacgagttcccgttcgtgcg
cggcgtcgaggacctcctCGTGCTCTCCATCGGGGGATGCTCCGCCGGTGGCACGGGGGc
cgcggccgacgccgacctccgacgcttgcgccgctggggtcccaaggattgggcgcgccc
catcgcgcgcatcgccgccgacggcgccgccgacctcgtcgaccacgccgtggcgcgcgc
cttcgggcagtgccgctcgtccAACTACCTGCGCATTCAGGCGAAACGGGAGAGCATGCC
GCCGTGCGGGCCGGACGGGGAGTACGACCCAACCCCGGCGAACGTGCACGCGCTGCTCGC
GGCGGCGGACGAGATGCTGAAGCACCGGAACGTGGAGTCGGTGCTGTTCGAAGGGAGGCG
TGTCGGCG

CDS

606 bp

>Os03t0254400-02 Similar to patatin-like protein 3.
ATGGAGGAGGCGGAGGAGATGCAGGTGGAGAGGATGCAGGAGGAGGTGGAGGGAGGCGGC
GCGGATACGGATAAGCTCAGCTACGAGATTTTCTCCATCCTCGAGAGCAAGTTCCTGTTC
GGGTACACGGACCCGCACCAGCTGTGGCTGCCCAAGGCGCCGGCGGCGCAGGCGTCGGCG
GCGACGGCCGTGCCGTCGGGGAAGGCGGCGCAGCGTGGGAAGGTGTGCGcgccgccgccg
caatcacgcacgtgcttcacaacaagcacgagttcccgttcgtgcgcggcgtcgaggacc
tcctCGTGCTCTCCATCGGGGGATGCTCCGCCGGTGGCACGGGGGccgcggccgacgccg
acctccgacgcttgcgccgctggggtcccaaggattgggcgcgccccatcgcgcgcatcg
ccgccgacggcgccgccgacctcgtcgaccacgccgtggcgcgcgccttcgggcagtgcc
gctcgtccAACTACCTGCGCATTCAGGCGAAACGGGAGAGCATGCCGCCGTGCGGGCCGG
ACGGGGAGTACGACCCAACCCCGGCGAACGTGCACGCGCTGCTCGCGGCGGCGGACGAGA
TGCTGA

Protein

202 aa

>Os03t0254400-02 Similar to patatin-like protein 3.
MEEAEEMQVERMQEEVEGGGADTDKLSYEIFSILESKFLFGYTDPHQLWLPKAPAAQASA
ATAVPSGKAAQRGKVCAPPPQSRTCFTTSTSSRSCAASRTSSCSPSGDAPPVARGPRPTP
TSDACAAGVPRIGRAPSRASPPTAPPTSSTTPWRAPSGSAARPTTCAFRRNGRACRRAGR
TGSTTQPRRTCTRCSRRRTRC*

5'UTR

chr03:8152544..8152977 (+ strand) : 434 bp

CDS

chr03:8152978..8153206 (+ strand) : 229 bp

chr03:8153814..8154090 (+ strand) : 277 bp

chr03:8154176..8154275 (+ strand) : 100 bp

3'UTR

chr03:8154276..8154323 (+ strand) : 48 bp

FASTA

>Os03t0254400-02 class=Sequence position=chr03:8152544..8154323 (+ strand)
GAGAGAGAGA GAGAGAGAGG AAGACGACGA CGACCTTTGT TGTTGTTTCC TTCTTTCTCT TCTCTTCTCC TCATCCTCCT
CTTTAGCTTC CTCTCGCGCT CGCCGTCTCT CTCTCTCTCT CTCTATCGGG CGCGCGCCTT TCTGTGTTGG TCGTCTCTTT
CCTCGCGTGC TCTGCCGCTG CGCAAGAATC AAAAGGCGCC GGCCACTAGA GAGAGTGTGT GTTTGTGTGT GTGTGGCTTG
AGTTGAGAGT TGAGAGACCA ATCGACCATC GGCTGTGATC TCAAAAGAGA GAGAGGGGCA AAGCGAAGTG GGCAGACTTG
GGCGGCAATC CTTGCGAATC ATCAAGGGAT TCTGTCTTTT CTTTGGTGCG ATTCGATTGT TTCTTTGTAG GGGGAAGGGA
GAGAGGAGGG GGGGGGGGGG TTTTGGCAAT TGGCATGGAG GAGGCGGAGG AGATGCAGGT GGAGAGGATG CAGGAGGAGG
TGGAGGGAGG CGGCGCGGAT ACGGATAAGC TCAGCTACGA GATTTTCTCC ATCCTCGAGA GCAAGTTCCT GTTCGGGTAC
ACGGACCCGC ACCAGCTGTG GCTGCCCAAG GCGCCGGCGG CGCAGGCGTC GGCGGCGACG GCCGTGCCGT CGGGGAAGGC
GGCGCAGCGT GGGAAGGTGT GCGTGCTGTG CGTGGATGGC GGCGGCGGCG GGCTGCGGGC GCTGCTCTCC GGCCgcgcgc
tggcgcacct ggaggccgcg ctccggcgcg cgtcgggcga cccggacgcc cgcgtcgcgg actacttcga cctcgtcgcc
ggtacgggcg ccggcggcgt gttcgccgcg atgctgttct cgacgcactc gcgcggcgcg cctctgttcc acgccgatga
cacatggcgc ctcgtggctg accacgctcc ccggctcttc cgcaaggccg tcggcggctc gacgtcgctc ttctgccgac
ccaagaagcg gcccctcgcg gcgccgacgg cggcgctgga cgcggccatg aagacggcgt tcggcgagga gctcACCCTG
CGGGATACCA TCAAGCCCGT GCTCATCTCC TGCTACGACC TCAAGTCGTC CGCGCCGCTC GTGTTCTCGC GCGCCGACGC
CCTggagagc gagagctacg acttccgcct ctgcgaggtc ggccgcgcgg cgtggtcgga ggccggccga ttcgagcccg
ccgaggtcgc gtcggtcgac ggcgccacgt cctgcgccgc cgtggacggc gggccgatca tgggcagccc cgccgccgcc
gcaatcacgc acgtgcttca caacaagcac gagttcccgt tcgtgcgcgg cgtcgaggac ctcctCGTGC TCTCCATCGG
GGGATGCTCC GCCGGTGGCA CGGGGGccgc ggccgacgcc gacctccgac gcttgcgccg ctggggtccc aaggattggg
cgcgccccat cgcgcgcatc gccgccgacg gcgccgccga cctcgtcgac cacgccgtgg cgcgcgcctt cgggcagtgc
cgctcgtccA ACTACCTGCG CATTCAGGTG AGCAAATTCT CCCACTGCAT TGCGCATTTC GAACGAACGT TCCCTCGGAT
TAACCCTGGT ACAAATTCTC CGCCATGATC AGGCGAAACG GGAGAGCATG CCGCCGTGCG GGCCGGACGG GGAGTACGAC
CCAACCCCGG CGAACGTGCA CGCGCTGCTC GCGGCGGCGG ACGAGATGCT GAAGCACCGG AACGTGGAGT CGGTGCTGTT
CGAAGGGAGG CGTGTCGGCG