Os03t0259400-00

Locus

Os03g0259400

Description

Similar to Leucoanthocyanidin reductase (EC 1.17.1.3) (Leucocyanidin reductase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

LAR

CGSNL Gene Name

LEUCOANTHOCYANIDIN REDUCTASE

Oryzabase Gene Symbol Synonym(s)

OsLAR

Oryzabase Gene Name Synonym(s)

leucoanthocyanidin reductase

Transcript Evidence

AK376794 (DDBJ)

Protein Evidence

Q3KN74 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Functional domain (InterPro)

NmrA-like (IPR008030)

NAD(P)-binding domain (IPR016040)

Expression Databases

TENOR (Os03t0259400-00)

Others

Oryzabase (14088)

Transcript

1121 bp

>Os03t0259400-00 Similar to Leucoanthocyanidin reductase (EC 1.17.1.3) (Leucocyanidin reductase).
ATGGCGCCTGCTGCTCAGGAGCTGCTGCTGCAAGAAGTGCCGCAGCCTCGCCGCACCGGC
GCGGCCCTCATCGTGGGCGCCACCGGCTACATCGGCCGTTTCGTCGCCGAGGCCTGCCTC
GACAGCGGCCGCGACACCTTCATCCTCGTCCGCCCCGGGAACGCCTGCCCCGCGCGCGCC
GCCTCCGTCGACGCGCTCCGCCAGAAAGGCGCCGTCGTCATCGAGGGCTGCGTCGGGGGG
AAGGAGGGGAGGAAGTCCGTGGAGGCGGCGCTCCGCGCGCGCGGCGTCGAGGTGGTGATC
TCGGTGATGGGCGGCGCCAGCATCCTCGACCAGCTCGGCCTCATCGAGGCCATCCGAGCT
GCAGGCACGGTCAAAAGGTTTCTGCCGTCGGAGTTCGGGCACGACGTGGACAGGGCGCGG
CCGGTGGGGGCGGGGCTGAGGTTCTACGAGGAGAAGCGGCTGGTGCGGCGGGCGGCGGAG
GCGTCGGGCGTGCCGTACACCTTCATCTGCTGCAACTCCATCGCCGGCTGGCCCTACCAC
GACAGCACGCACCCGTCCGAGCTGCCGCCGCCGCTCGACCGCTTCCAGATCTACGGCGAC
GGCGACGTCAGAGCTTTCTTCGTGGCTGGAAGCGACATTGGTAAGTTCACCATCAGGGCT
GCCTACGACGCCCGGAGCATCAACAAGATCGTGCACTTCCGTCCCGCCTGCAATCTCCTC
AGCACGAACGAGATGGCGTCGCTGTGGGAGAGCAAGATCGGCCGGACACTGCCACGCGTG
ACGCTTACCGAGGAGGACTTGATCGCCATGGCTGCAGATGACATCATCCCGGAGAGCATA
GTCGCTTCACTGACGCATGACATTTTTATAAACGGTTGCCAGACACATTTCTACATAGAC
GGGCCTAGAGACATTGAAATCTCAAGCCTTTACCCTGATATTCCCTTCAGAACAATAGAC
GAATGCTTCGACGACTACATACATGTCCTCAACCTAGCAGAGGAAGCTAAAGAAGAGGAG
GAGAAGAAGAACGCGCCAACAGTTGGGAGATTGGCAATACCACCTACTTGTGCTTAGGTC
CTCATAAGAAGTCCTGAAACAATTACCTTCTCGTGTTTCTT

CDS

1077 bp

>Os03t0259400-00 Similar to Leucoanthocyanidin reductase (EC 1.17.1.3) (Leucocyanidin reductase).
ATGGCGCCTGCTGCTCAGGAGCTGCTGCTGCAAGAAGTGCCGCAGCCTCGCCGCACCGGC
GCGGCCCTCATCGTGGGCGCCACCGGCTACATCGGCCGTTTCGTCGCCGAGGCCTGCCTC
GACAGCGGCCGCGACACCTTCATCCTCGTCCGCCCCGGGAACGCCTGCCCCGCGCGCGCC
GCCTCCGTCGACGCGCTCCGCCAGAAAGGCGCCGTCGTCATCGAGGGCTGCGTCGGGGGG
AAGGAGGGGAGGAAGTCCGTGGAGGCGGCGCTCCGCGCGCGCGGCGTCGAGGTGGTGATC
TCGGTGATGGGCGGCGCCAGCATCCTCGACCAGCTCGGCCTCATCGAGGCCATCCGAGCT
GCAGGCACGGTCAAAAGGTTTCTGCCGTCGGAGTTCGGGCACGACGTGGACAGGGCGCGG
CCGGTGGGGGCGGGGCTGAGGTTCTACGAGGAGAAGCGGCTGGTGCGGCGGGCGGCGGAG
GCGTCGGGCGTGCCGTACACCTTCATCTGCTGCAACTCCATCGCCGGCTGGCCCTACCAC
GACAGCACGCACCCGTCCGAGCTGCCGCCGCCGCTCGACCGCTTCCAGATCTACGGCGAC
GGCGACGTCAGAGCTTTCTTCGTGGCTGGAAGCGACATTGGTAAGTTCACCATCAGGGCT
GCCTACGACGCCCGGAGCATCAACAAGATCGTGCACTTCCGTCCCGCCTGCAATCTCCTC
AGCACGAACGAGATGGCGTCGCTGTGGGAGAGCAAGATCGGCCGGACACTGCCACGCGTG
ACGCTTACCGAGGAGGACTTGATCGCCATGGCTGCAGATGACATCATCCCGGAGAGCATA
GTCGCTTCACTGACGCATGACATTTTTATAAACGGTTGCCAGACACATTTCTACATAGAC
GGGCCTAGAGACATTGAAATCTCAAGCCTTTACCCTGATATTCCCTTCAGAACAATAGAC
GAATGCTTCGACGACTACATACATGTCCTCAACCTAGCAGAGGAAGCTAAAGAAGAGGAG
GAGAAGAAGAACGCGCCAACAGTTGGGAGATTGGCAATACCACCTACTTGTGCTTAG

Protein

359 aa

>Os03t0259400-00 Similar to Leucoanthocyanidin reductase (EC 1.17.1.3) (Leucocyanidin reductase).
MAPAAQELLLQEVPQPRRTGAALIVGATGYIGRFVAEACLDSGRDTFILVRPGNACPARA
ASVDALRQKGAVVIEGCVGGKEGRKSVEAALRARGVEVVISVMGGASILDQLGLIEAIRA
AGTVKRFLPSEFGHDVDRARPVGAGLRFYEEKRLVRRAAEASGVPYTFICCNSIAGWPYH
DSTHPSELPPPLDRFQIYGDGDVRAFFVAGSDIGKFTIRAAYDARSINKIVHFRPACNLL
STNEMASLWESKIGRTLPRVTLTEEDLIAMAADDIIPESIVASLTHDIFINGCQTHFYID
GPRDIEISSLYPDIPFRTIDECFDDYIHVLNLAEEAKEEEEKKNAPTVGRLAIPPTCA*

CDS

chr03:8408072..8408296 (- strand) : 225 bp

chr03:8407836..8407985 (- strand) : 150 bp

chr03:8407490..8407727 (- strand) : 238 bp

chr03:8407195..8407398 (- strand) : 204 bp

chr03:8406853..8407112 (- strand) : 260 bp

3'UTR

chr03:8406809..8406852 (- strand) : 44 bp

FASTA

>Os03t0259400-00 class=Sequence position=chr03:8406809..8408296 (- strand)
ATGGCGCCTG CTGCTCAGGA GCTGCTGCTG CAAGAAGTGC CGCAGCCTCG CCGCACCGGC GCGGCCCTCA TCGTGGGCGC
CACCGGCTAC ATCGGCCGTT TCGTCGCCGA GGCCTGCCTC GACAGCGGCC GCGACACCTT CATCCTCGTC CGCCCCGGGA
ACGCCTGCCC CGCGCGCGCC GCCTCCGTCG ACGCGCTCCG CCAGAAAGGC GCCGTCGTCA TCGAGGTGAT TAGAGTTTAA
AATTAACCAA CTTAGTTAAG CGCGCGGAAA TGAACACATA TTTGGATTCA TGGCGTGTGT GCTCGTGACA GGGCTGCGTC
GGGGGGAAGG AGGGGAGGAA GTCCGTGGAG GCGGCGCTCC GCGCGCGCGG CGTCGAGGTG GTGATCTCGG TGATGGGCGG
CGCCAGCATC CTCGACCAGC TCGGCCTCAT CGAGGCCATC CGAGCTGCAG GCACGGTCAA AGTACGTACA CTACACATTT
TACATACGAG CGCGTGCATG CGCGCGTCGC ACAACTCGGA TTTTTGGCAC GTAAAGTTTG GTCTGCGCGG TGCGTGTGCG
TGGGTGCAGA GGTTTCTGCC GTCGGAGTTC GGGCACGACG TGGACAGGGC GCGGCCGGTG GGGGCGGGGC TGAGGTTCTA
CGAGGAGAAG CGGCTGGTGC GGCGGGCGGC GGAGGCGTCG GGCGTGCCGT ACACCTTCAT CTGCTGCAAC TCCATCGCCG
GCTGGCCCTA CCACGACAGC ACGCACCCGT CCGAGCTGCC GCCGCCGCTC GACCGCTTCC AGATCTACGG CGACGGCGAC
GTCAGAGGTA CGTAGTACAC GCTCATGCTT GCGCCGCATG ATGAAATTCA CCTTCGATGC GATTTTGCCA ACGGTGTGCT
GCATGCGCGC GCGTGCAGCT TTCTTCGTGG CTGGAAGCGA CATTGGTAAG TTCACCATCA GGGCTGCCTA CGACGCCCGG
AGCATCAACA AGATCGTGCA CTTCCGTCCC GCCTGCAATC TCCTCAGCAC GAACGAGATG GCGTCGCTGT GGGAGAGCAA
GATCGGCCGG ACACTGCCAC GCGTGACGCT TACCGAGGAG GACTTGATCG CCATGGCTGC AGGTTTGGCC ACCTAAAAGA
ATACTCTCGC GCTCTAAATG GAATTTTGTC ATGGTGTATG ATCTATTCAT CATTTTGACT GCAGATGACA TCATCCCGGA
GAGCATAGTC GCTTCACTGA CGCATGACAT TTTTATAAAC GGTTGCCAGA CACATTTCTA CATAGACGGG CCTAGAGACA
TTGAAATCTC AAGCCTTTAC CCTGATATTC CCTTCAGAAC AATAGACGAA TGCTTCGACG ACTACATACA TGTCCTCAAC
CTAGCAGAGG AAGCTAAAGA AGAGGAGGAG AAGAAGAACG CGCCAACAGT TGGGAGATTG GCAATACCAC CTACTTGTGC
TTAGGTCCTC ATAAGAAGTC CTGAAACAAT TACCTTCTCG TGTTTCTT

Locus: Os03g0259400

Loading...

Locus: Os03g0259400

Loading...