Os03t0259500-00

Locus

Os03g0259500

Description

Similar to Ubiquitin.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBL40-2

CGSNL Gene Name

UBIQUITIN FUSION RIBOSOMAL PROTEIN L40-2

Oryzabase Gene Symbol Synonym(s)

UbL40-2, OsUbL40-2

Oryzabase Gene Name Synonym(s)

Ubiquitin fusion protein, ubiquitin fusion ribosomal protein L40-2

Transcript Evidence

EU952795 (DDBJ)

Protein Evidence

P0CH35 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translation (GO:0006412)

Cellular Component: ribosome (GO:0005840)

Molecular Function: structural constituent of ribosome (GO:0003735)

Functional domain (InterPro)

Ribosomal protein L40e (IPR001975)

Expression Databases

TENOR (Os03t0259500-00)

Others

Oryzabase (17713)

KEGG (Os03t0259500-00)

Transcript

678 bp

>Os03t0259500-00 Similar to Ubiquitin.
GGCCGCACAATCCGCGCCGCCATCAGTTCGCTCTCGCCACCAACACCACCGCCATTTCCA
CTCGCTCGAGAGCACCAGATTAGCGGAGGAGATAGGGGTCCGCGACTCGCGAGGGAGAGG
AAAGCAAGCGGAGTTgaggatgcagatcttcgtgaagacgctgacggggaagaccatcac
cctcgaggtggagaacagcgacgccgtcgccaacgtcaaggccaagatccaggacaagga
aggtatcccgccggaccagcagcgcctcatcttcgccgggaagcagctggaggatggccg
cacgctggccgactacaacatccagaaggagtccacgcttcacctggtgcttcgcctacg
cggcggccacatctGGATCGAGCCCTCGCTCAGGGTCCTCGCCTACAAGCACAACATCAA
CAAGATGGTCTGCAGGAAGTAATACTACTCGCGCACCGCTCCCTTCTTACTATAAGGCAA
TTTGGTCGAGAATTTTGTGCTTGCAAGGTTTATTGCACAATTTGTCTTTTTTTGTTCACC
CCTTTGTCTTGCAGGTGCTATGCAACTCTGCCTCCCAGGGCTACAAACTGCCGCAAGAAG
AAGTGTGGCCACAGCAATCAGGTGAGCCTTATCACCATAAACCATGTTTTCAGTCTTAGT
GATCATGTCCTAATATGA

CDS

678 bp

>Os03t0259500-00 Similar to Ubiquitin.
GGCCGCACAATCCGCGCCGCCATCAGTTCGCTCTCGCCACCAACACCACCGCCATTTCCA
CTCGCTCGAGAGCACCAGATTAGCGGAGGAGATAGGGGTCCGCGACTCGCGAGGGAGAGG
AAAGCAAGCGGAGTTgaggatgcagatcttcgtgaagacgctgacggggaagaccatcac
cctcgaggtggagaacagcgacgccgtcgccaacgtcaaggccaagatccaggacaagga
aggtatcccgccggaccagcagcgcctcatcttcgccgggaagcagctggaggatggccg
cacgctggccgactacaacatccagaaggagtccacgcttcacctggtgcttcgcctacg
cggcggccacatctGGATCGAGCCCTCGCTCAGGGTCCTCGCCTACAAGCACAACATCAA
CAAGATGGTCTGCAGGAAGTAATACTACTCGCGCACCGCTCCCTTCTTACTATAAGGCAA
TTTGGTCGAGAATTTTGTGCTTGCAAGGTTTATTGCACAATTTGTCTTTTTTTGTTCACC
CCTTTGTCTTGCAGGTGCTATGCAACTCTGCCTCCCAGGGCTACAAACTGCCGCAAGAAG
AAGTGTGGCCACAGCAATCAGGTGAGCCTTATCACCATAAACCATGTTTTCAGTCTTAGT
GATCATGTCCTAATATGA

Protein

226 aa

>Os03t0259500-00 Similar to Ubiquitin.
GRTIRAAISSLSPPTPPPFPLAREHQISGGDRGPRLARERKASGVEDADLREDADGEDHH
PRGGEQRRRRQRQGQDPGQGRYPAGPAAPHLRREAAGGWPHAGRLQHPEGVHASPGASPT
RRPHLDRALAQGPRLQAQHQQDGLQEVILLAHRSLLTIRQFGREFCACKVYCTICLFLFT
PLSCRCYATLPPRATNCRKKKCGHSNQVSLITINHVFSLSDHVLI*

CDS

chr03:8409910..8410151 (+ strand) : 242 bp

chr03:8410328..8410554 (+ strand) : 227 bp

chr03:8411199..8411407 (+ strand) : 209 bp

FASTA

>Os03t0259500-00 class=Sequence position=chr03:8409910..8411407 (+ strand)
GGCCGCACAA TCCGCGCCGC CATCAGTTCG CTCTCGCCAC CAACACCACC GCCATTTCCA CTCGCTCGAG AGCACCAGAT
TAGCGGAGGA GATAGGGGTC CGCGACTCGC GAGGGAGAGG AAAGCAAGCG GAGTTgagga tgcagatctt cgtgaagacg
ctgacgggga agaccatcac cctcgaggtg gagaacagcg acgccgtcgc caacgtcaag gccaagatcc aggacaagga
aggtaaccct gctctcttac tgctcgtgtt gcgagtttga gactgcggtt gcatatcgat ctctctgccc ccatctgctt
gttgcatttg cccgatcaga tcagtagcaa agaattcgtg gatttgggtt ggtcggtgac tggggttttt ggctgactaa
ttgtttctgt gcttgtaggt atcccgccgg accagcagcg cctcatcttc gccgggaagc agctggagga tggccgcacg
ctggccgact acaacatcca gaaggagtcc acgcttcacc tggtgcttcg cctacgcggc ggccacatct GGATCGAGCC
CTCGCTCAGG GTCCTCGCCT ACAAGCACAA CATCAACAAG ATGGTCTGCA GGAAGTAATA CTACTCGCGC ACCGCTCCCT
TCTTAGTTCT TACATCGATC TATCGCAACC TGAGATGTTG TTGAGTTGGT CGTGCTTGCT TAGATGAGTT TTGTTAGCGA
TGAACAGTTC AGTATTTTAG TTGGATGCAT TCTATTACGA GTCAGCTATG ATCAATGTGA GCACCTTGTC GATGTCTCAC
CAATCCACCA TACTGGATCG TTTTAATTTC AGTTTTTTTT TCTAACAGCA GGGGCACTAG GCCACTGGCA CCACAAAGGC
ACAAAGTCCT CTCTCACTGT GATATACTGT TGCCGTCAGG TTTATGTTTA TTCACGTCAT GTAGTTAGTT GGATCGATAT
AAGGTTGATA GGCAATGCAA GCAGGAAGGT TCAATTGCGA ACCAGCCAGA TCGGCACACA TATACATTCT GTTTCGGGTG
TGTCAGTTTA GTCATCAATA CTTTTGAAAG AATTTACAAA TTGTACCATG CTGCAAGTCG TTTGATTACT TTGTTCACTC
TTTGCCCTTT CTATGGCTTG GTGAGAGCTG TGCTGTTACT CGTTTACGTT ATTGGGACGG TTGTTTGGTA GAAAAAATGA
TCGATCGATC CGATGCGCAA GATAAGCTGT GTTTCAAAAT CTCTCAATGT GCATACATAT AGTCTCCCTA GTCCTTTATA
TTTGGTCAGC TATAAGGCAA TTTGGTCGAG AATTTTGTGC TTGCAAGGTT TATTGCACAA TTTGTCTTTT TTTGTTCACC
CCTTTGTCTT GCAGGTGCTA TGCAACTCTG CCTCCCAGGG CTACAAACTG CCGCAAGAAG AAGTGTGGCC ACAGCAATCA
GGTGAGCCTT ATCACCATAA ACCATGTTTT CAGTCTTAGT GATCATGTCC TAATATGA

Locus: Os03g0259500

Loading...

Locus: Os03g0259500

Loading...