Os03t0268200-02

Locus

Os03g0268200

Description

Similar to Protein kinase domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ATG1A

CGSNL Gene Name

AUTOPHAGY ASSOCIATED GENE 1A

Oryzabase Gene Symbol Synonym(s)

OsATG1a

Oryzabase Gene Name Synonym(s)

autophagy 1a

Transcript Evidence

AK069243 (DDBJ, Best hit)

Protein Evidence

Q10NJ0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Serine/threonine-protein kinase, C-terminal (IPR022708)

Full-length cDNA

J023010P21 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0268200-02)

RiceXPro (AK069243)

Others

Oryzabase (9632)

KEGG (Os03t0268200-02 (EC:2.7.11.1))

Transcript

2696 bp

>Os03t0268200-02 Similar to Protein kinase domain containing protein, expressed.
GCGAGTAGAGACCTGGCCCTCCTCCCCTTTTCTCTCTCTGTTCCGCGCGGCGAGATAATT
CGGTTGCTTCTCCCCGCGGCCGCGGCGGCATCTCTCCCGGCGGCGGCGGAGCTCACGTCC
TTCGCGGCGAACTGCGCTCCAGGCAGCGGGACCAGAGGGGATGGGGGACCGCGCCGCGGG
GAGCGGCGGCGGGGGAGGGGGAGGAAGCGGCGTGCGGAGGGTAGGGGACTACGTGCTGGT
GCGGCAGATCGGGTCGGGGGCGTACGCGCGGGTCTGGCTCGGGAAGCACCGCACGCGGGG
CACGGAGGTGGCCTTGAAGGAGATCGCCGTGGAGCGGCTTAGCAGCAAGCTCCGCGAGAG
CCTCCTCTCCGAGGTCGACATCCTCCGGCGCATCCGTCATCCCAACGTCATCGCCCTCCA
CGAGTCCATCAGGGATGGTGGGAAAATATATCTTGTATTAGAGTACTGTCGAGGTGGTGA
CTTACACTCATACCTTCAGCAGCATAAAAGGGTTTCTGAAACAGTTGCTAAGCATTTCAT
CCAGCAGCTAGCATCTGGTCTGCAGATGCTGCGTGAAAACAACGTGGTTCATCGAGATCT
AAAACCACAGAACATTCTTCTAGTTGCAAATAATGAAAATTCCCTCTTGAAGATTGCGGA
CTTTGGATTTGCAAAGTTTTTAGAACCTTCTTCTCTGGCTGAAACACTTTGCGGTTCACC
GCTTTACATGGCTCCAGAAGTCATGCAAGCTCAGAAGTATGATGCAAAGGCAGATTTGTG
GAGTGTTGGTATAATTCTATATCAACTTGTTACCGGATCTCCTCCTTTTACCGGGGATAG
TCAAATCCAGTTGCTGAGAAATATACTCAATACACGAGAAATACGATTTCCATCTGATTG
CGACTTGAGCCATGGCTGCATTGACTTATGCAGAAAGTTACTGCGAATCAATTCAGTGGA
ACGCCTTACCGTTGAAGAGTTTGTGAACCATCCATTTCTCGCTGAACATGCTTTGGAGAG
AACCTTGAGCCGGACACCATCGGACATAAGAGATGGCTTTCCATTCATTAATAGCAGTCC
TACGAGACCTTCAAGCCAAAGTTCTCAGGAAGATTGTATGCCTTTTCCTTTGGATGATGA
GTCAACTGGACAGGATGAAGGTCCTGTTTCTGATAGTAAGAGTGCAATAAAATCCTATGG
GTTTGCCACGAGTAAAAGGCTTGATAAAACTTCAGGTCAGAGTCCAACGAAACATTCAAG
TCTGGTCTCTAAATATATTAGGGGAAATAATTACGCATCTAGTAGTCAACGCCTGGACCA
TCCTAGGAGAATCAAGGAAAACAAGGGTGATGAAGGGCACAACCCTAAAGGTGGTTATCC
AGAAGATTCCCCTATCATTGATTCATTAGAGTTTGTAGATCAGGAATATGTCTTTGTGCA
CCCAGAGGGATCCTCCTCTTCGATGAATGACTCCCGACAGCGCACCATGCCATCAAAACT
TGACAGTTCTTCTCTTTCACCACCGAAGTTATTAACTGCTGTGAGTGCACCAAGGCCAAT
ACATGGCATGGCAATTAACAGACAGCAATCTGGTGGAACTGGTAGCTTGGACAGTCACTG
CTCTCCAGTATCTGGTACTTCACAAGGATCTGCAGATCTCAACGATGCTATGGATCAACC
ACCATCTGATTGTCTGACCAGGGTTAGATTATTGGAGCAGTATGCGTCTACCATAGCAGA
ATTGGTGAAAGAAAAGATTAAAGATGCCAAGCACTTAGAGGGATTCTCGATTCAGCTAGT
TGTTCTTGCAACCTGGAAGCAAGCAATTTACATCTGCACTTCTTATGCATCTTCTGCCAC
AAGAGAGAATCCTTCCCATGATGTCACCGCGAAGGGTTTTGGCTCAAATGCTCCCCATTT
GCTTGCAAACTCTCAACTGTTATATGATACATGCATGGAGATAGAGAGTCAGTTTTTGGT
TCAAATGGAATATGCTGAAGAACTTGCCAACACTATAGGACAGACAGTTGATGCTACAGA
AATGCCAGATGCGATAGAAATCATATTTCAGACCGCGCTTAACCTGGGAAGACATGGTGG
TGTTGATGAGATGATGGGGAAATCAGCATCTGCCATGGTGCTGTACTCGAAGGCAGTATC
CATGCTGCGCTTTCTCCTGACTGAGGCACCGTCACTCGCCCTGAACCCCGCTCTGTCCCT
AACAAGAGATGATCGACGCCGCCTGCGCACATACATTGAAGCCGTTAACGCTAGGCTCGT
CCCGTTGCAATACCAGCGGCACTGACCGCTCACCTGTACAATATTCTTTCATCCTGTACA
TATATTCGTTGGCCCAAACGAGGGCGTGTAAGATATGTCATGTCTGAGAACGTGCTCCGA
TTAGGGAGAAGTAGCGAAAAATCCAGTGTAACTTGCCCAAACTGCCTACTGTAACGTGAG
CTCGGTGTGCTTGCATGGTACGCCTGATTATCAGGCAGCTCAGGTTGGCAGCTGAAGGCC
CGACCATGGTCGTTTGTGGACATGTAAAGCAGACTGCTACCTCGATGGTTTGTTCATTAA
AATTTGGGCTTTTACACTGCATATGTTGTCCAAGTCATCGTTGATTTTGAGTTGTGCTGT
CTAACTTGTCCAAGTCCTGTTAATTATGAATTGAATTTGTGTGTGTGTTTTTTCTC

CDS

2145 bp

>Os03t0268200-02 Similar to Protein kinase domain containing protein, expressed.
ATGGGGGACCGCGCCGCGGGGAGCGGCGGCGGGGGAGGGGGAGGAAGCGGCGTGCGGAGG
GTAGGGGACTACGTGCTGGTGCGGCAGATCGGGTCGGGGGCGTACGCGCGGGTCTGGCTC
GGGAAGCACCGCACGCGGGGCACGGAGGTGGCCTTGAAGGAGATCGCCGTGGAGCGGCTT
AGCAGCAAGCTCCGCGAGAGCCTCCTCTCCGAGGTCGACATCCTCCGGCGCATCCGTCAT
CCCAACGTCATCGCCCTCCACGAGTCCATCAGGGATGGTGGGAAAATATATCTTGTATTA
GAGTACTGTCGAGGTGGTGACTTACACTCATACCTTCAGCAGCATAAAAGGGTTTCTGAA
ACAGTTGCTAAGCATTTCATCCAGCAGCTAGCATCTGGTCTGCAGATGCTGCGTGAAAAC
AACGTGGTTCATCGAGATCTAAAACCACAGAACATTCTTCTAGTTGCAAATAATGAAAAT
TCCCTCTTGAAGATTGCGGACTTTGGATTTGCAAAGTTTTTAGAACCTTCTTCTCTGGCT
GAAACACTTTGCGGTTCACCGCTTTACATGGCTCCAGAAGTCATGCAAGCTCAGAAGTAT
GATGCAAAGGCAGATTTGTGGAGTGTTGGTATAATTCTATATCAACTTGTTACCGGATCT
CCTCCTTTTACCGGGGATAGTCAAATCCAGTTGCTGAGAAATATACTCAATACACGAGAA
ATACGATTTCCATCTGATTGCGACTTGAGCCATGGCTGCATTGACTTATGCAGAAAGTTA
CTGCGAATCAATTCAGTGGAACGCCTTACCGTTGAAGAGTTTGTGAACCATCCATTTCTC
GCTGAACATGCTTTGGAGAGAACCTTGAGCCGGACACCATCGGACATAAGAGATGGCTTT
CCATTCATTAATAGCAGTCCTACGAGACCTTCAAGCCAAAGTTCTCAGGAAGATTGTATG
CCTTTTCCTTTGGATGATGAGTCAACTGGACAGGATGAAGGTCCTGTTTCTGATAGTAAG
AGTGCAATAAAATCCTATGGGTTTGCCACGAGTAAAAGGCTTGATAAAACTTCAGGTCAG
AGTCCAACGAAACATTCAAGTCTGGTCTCTAAATATATTAGGGGAAATAATTACGCATCT
AGTAGTCAACGCCTGGACCATCCTAGGAGAATCAAGGAAAACAAGGGTGATGAAGGGCAC
AACCCTAAAGGTGGTTATCCAGAAGATTCCCCTATCATTGATTCATTAGAGTTTGTAGAT
CAGGAATATGTCTTTGTGCACCCAGAGGGATCCTCCTCTTCGATGAATGACTCCCGACAG
CGCACCATGCCATCAAAACTTGACAGTTCTTCTCTTTCACCACCGAAGTTATTAACTGCT
GTGAGTGCACCAAGGCCAATACATGGCATGGCAATTAACAGACAGCAATCTGGTGGAACT
GGTAGCTTGGACAGTCACTGCTCTCCAGTATCTGGTACTTCACAAGGATCTGCAGATCTC
AACGATGCTATGGATCAACCACCATCTGATTGTCTGACCAGGGTTAGATTATTGGAGCAG
TATGCGTCTACCATAGCAGAATTGGTGAAAGAAAAGATTAAAGATGCCAAGCACTTAGAG
GGATTCTCGATTCAGCTAGTTGTTCTTGCAACCTGGAAGCAAGCAATTTACATCTGCACT
TCTTATGCATCTTCTGCCACAAGAGAGAATCCTTCCCATGATGTCACCGCGAAGGGTTTT
GGCTCAAATGCTCCCCATTTGCTTGCAAACTCTCAACTGTTATATGATACATGCATGGAG
ATAGAGAGTCAGTTTTTGGTTCAAATGGAATATGCTGAAGAACTTGCCAACACTATAGGA
CAGACAGTTGATGCTACAGAAATGCCAGATGCGATAGAAATCATATTTCAGACCGCGCTT
AACCTGGGAAGACATGGTGGTGTTGATGAGATGATGGGGAAATCAGCATCTGCCATGGTG
CTGTACTCGAAGGCAGTATCCATGCTGCGCTTTCTCCTGACTGAGGCACCGTCACTCGCC
CTGAACCCCGCTCTGTCCCTAACAAGAGATGATCGACGCCGCCTGCGCACATACATTGAA
GCCGTTAACGCTAGGCTCGTCCCGTTGCAATACCAGCGGCACTGA

Protein

714 aa

>Os03t0268200-02 Similar to Protein kinase domain containing protein, expressed.
MGDRAAGSGGGGGGGSGVRRVGDYVLVRQIGSGAYARVWLGKHRTRGTEVALKEIAVERL
SSKLRESLLSEVDILRRIRHPNVIALHESIRDGGKIYLVLEYCRGGDLHSYLQQHKRVSE
TVAKHFIQQLASGLQMLRENNVVHRDLKPQNILLVANNENSLLKIADFGFAKFLEPSSLA
ETLCGSPLYMAPEVMQAQKYDAKADLWSVGIILYQLVTGSPPFTGDSQIQLLRNILNTRE
IRFPSDCDLSHGCIDLCRKLLRINSVERLTVEEFVNHPFLAEHALERTLSRTPSDIRDGF
PFINSSPTRPSSQSSQEDCMPFPLDDESTGQDEGPVSDSKSAIKSYGFATSKRLDKTSGQ
SPTKHSSLVSKYIRGNNYASSSQRLDHPRRIKENKGDEGHNPKGGYPEDSPIIDSLEFVD
QEYVFVHPEGSSSSMNDSRQRTMPSKLDSSSLSPPKLLTAVSAPRPIHGMAINRQQSGGT
GSLDSHCSPVSGTSQGSADLNDAMDQPPSDCLTRVRLLEQYASTIAELVKEKIKDAKHLE
GFSIQLVVLATWKQAIYICTSYASSATRENPSHDVTAKGFGSNAPHLLANSQLLYDTCME
IESQFLVQMEYAEELANTIGQTVDATEMPDAIEIIFQTALNLGRHGGVDEMMGKSASAMV
LYSKAVSMLRFLLTEAPSLALNPALSLTRDDRRRLRTYIEAVNARLVPLQYQRH*

5'UTR

chr03:8901820..8901979 (- strand) : 160 bp

CDS

chr03:8901547..8901819 (- strand) : 273 bp

chr03:8900861..8900978 (- strand) : 118 bp

chr03:8900713..8900771 (- strand) : 59 bp

chr03:8900508..8900572 (- strand) : 65 bp

chr03:8899559..8899652 (- strand) : 94 bp

chr03:8899387..8899467 (- strand) : 81 bp

chr03:8899199..8899304 (- strand) : 106 bp

chr03:8898450..8898522 (- strand) : 73 bp

chr03:8898019..8898374 (- strand) : 356 bp

chr03:8897558..8897928 (- strand) : 371 bp

chr03:8897035..8897308 (- strand) : 274 bp

chr03:8896881..8896951 (- strand) : 71 bp

chr03:8896577..8896780 (- strand) : 204 bp

3'UTR

chr03:8896186..8896576 (- strand) : 391 bp

FASTA

>Os03t0268200-02 class=Sequence position=chr03:8896186..8901979 (- strand)
GCGAGTAGAG ACCTGGCCCT CCTCCCCTTT TCTCTCTCTG TTCCGCGCGG CGAGATAATT CGGTTGCTTC TCCCCGCGGC
CGCGGCGGCA TCTCTCCCGG CGGCGGCGGA GCTCACGTCC TTCGCGGCGA ACTGCGCTCC AGGCAGCGGG ACCAGAGGGG
ATGGGGGACC GCGCCGCGGG GAGCGGCGGC GGGGGAGGGG GAGGAAGCGG CGTGCGGAGG GTAGGGGACT ACGTGCTGGT
GCGGCAGATC GGGTCGGGGG CGTACGCGCG GGTCTGGCTC GGGAAGCACC GCACGCGGGG CACGGAGGTG GCCTTGAAGG
AGATCGCCGT GGAGCGGCTT AGCAGCAAGC TCCGCGAGAG CCTCCTCTCC GAGGTCGACA TCCTCCGGCG CATCCGTCAT
CCCAACGTCA TCGCCCTCCA CGAGTCCATC AGGGTACCCC GATCCTCGGA TCAACGCCCT TCTACTGTTT ATATTTTGCG
CAATTGCGTT CGATTTGTTA GGATTTCATG CGGACGGCGA CTGTTTATAA ACCTCGGATG AATAAAATCG GGAGTTCTTA
TAGTCTCTCT TTTAGTTGAA TTCTTCTGAG CTTTCTTGGT ATTCAGATGC CTCAAGCAAA GGAGAACTCA TTGGGCTTGA
CGTTCATTTG GGTGGTGATA CTATGCAAAG TTTTAACTTA ATGCTAGTAC CATAGCGTAA GTTGTTTAAC TTTGGATGTT
TGTTCGCTGG CTGTGGAAGC AAAACATTAA AATTCCAAAT TTGGTAACTT GTTTGTTTTG GATATATTTT CTGGTGGAAT
TTAGGAAACT ATACCATTAG TTGTTCCCTC CTTAGAGTTC AAAAGCATAC CTAACATGTT TAATTATGCC TCCGATATTA
ATATTTCTAG GTGTTCCACG AAAGGGAAGC TTCCCTCTAG GGAGATTGTT GGACATAATT ATTTCTTCAC TCTCATATCT
AACTATTATT TGCGTATCTC TTTGTTATTT GATGATTTTA GGATGGTGGG AAAATATATC TTGTATTAGA GTACTGTCGA
GGTGGTGACT TACACTCATA CCTTCAGCAG CATAAAAGGG TTTCTGAAAC AGTTGCTAAG CATTTCATCC AGCAGCTAGG
CAAGCACTTT CTCAGACCCT CAGTGTCTTG CACTATTTAT TGCTTTATCT CTCCCCAGAG CCAAAATCAC ATTCTCTTCT
TTATGCAGCA TCTGGTCTGC AGATGCTGCG TGAAAACAAC GTGGTTCATC GAGATCTAAA ACCACAGGTT AAATTATTTA
ATTTACTGTT ATTGAGTGGA TATTTCCATT ATATCTTCAT ATTTAATGAC AAAGAATTGA TGAAAGAAAC GGAATTTCCT
GACATTTTGT TTTGTTTTCT ATCCTGAATT TGTGGCTGTT CAAATAGAAC ATTCTTCTAG TTGCAAATAA TGAAAATTCC
CTCTTGAAGA TTGCGGACTT TGGATTTGCA AAGTAAGTTA CTTATGTTTG ATTGCTTTTA TTTTGGAGTT ATATTATCTT
ATTTTCCACA TGGCCTTTTT TATTGAGTTT ATCAGCAATG AGTTTGATAC CTGGTTTAAG AATCCCCTAA TAGGTCTGTA
GAAATCGCTC CTACCTGAAA TGAAATTGCA GTATTGTGAA AGAAACGGTG TTGTGCATTT TAAAATGGAA TAACTTCTCA
AGAAGTTCTG AAAAAAATAC AGTCAATTTG CACTATTTCA AAAGAAAAGG TGCATCATTT GAAAGTCTCA TCTTCATGTC
TTGAAAGATG TTAGAGACAT TCCATTTAAA GAATGAAATA TTATGTGCAT CACTTTTTAG GCCCCCTTCA GGATTTGGCT
CCACAACTAC AGCATGCCTT CATTGTTACA AAAAAATATT TCATGTACCA ATACACCTAT GTCGCATATG TATTACTCCA
ATTAAGCTAT CATTGTTACA AAAAAAAAAG CTATCTTGAG TCCAATTAAT TCTCTACACT CAATTCTACT TTTTTTTATT
GAACAGTCCT ACTCCGTAAT GTAATGTCCT TTGAATTCAC ACAGAGTTTT ACACAAAAAT CTGTGCATAA AAGCTAAGTA
CGAAACATTC TTGAGGACAA CTAGATAAGT ATCGTGCAGG GAAAGAGAAT AAGATCATGT TGCTTTGTGC TTGATCCTGT
GTTTCTCTGC TTCCTTGCAT ATTTAATTAC AGCCATGACA AAATTGGCAC CTCAGCTTTC TCTCTGCTTC TCATTCATCG
ATGGTTGGAT CAAGTGAGGC TTGGTGGGAG GGTTAGACGC GGATAGTATC AGAAATGTGT ACTTACCTTT TCTATTCTTG
CAAGCAGGTT TTTAGAACCT TCTTCTCTGG CTGAAACACT TTGCGGTTCA CCGCTTTACA TGGCTCCAGA AGTCATGCAA
GCTCAGAAGT ATGATGCAAA GGTCAGGGCT TTTTTCTGCT TCCTTGTGAG CTTTATCATG TACTTTTACC TGTTCTTGAC
TCGTGCTTCA TGCCCGATTT CTGACAGAAC AGGCAGATTT GTGGAGTGTT GGTATAATTC TATATCAACT TGTTACCGGA
TCTCCTCCTT TTACCGGGGA TAGTCAAATC CAGGTTTATT CAAATTTTCC ACATGACCTG ATTTCTAGTG CATTATTAAA
TCAGGCTACT ACTGAAAAAT GTTATTTCCC ATCAGTTGCT GAGAAATATA CTCAATACAC GAGAAATACG ATTTCCATCT
GATTGCGACT TGAGCCATGG CTGCATTGAC TTATGCAGAA AGTTACTGCG AATCAATTCA GGTACGAATC CTCTGCTACA
CTTATGTATA GTTATATATA AAAACAAGTT TCATAAGACT TCCACATGTC ATTATTTTTT CTTACATCCT TACCAGGAAG
GGTAAAATTT TCCAGAATTA TACTGTGACA TGACTGATAT TACGCCAAAG AAAAACATGA ATGACTATCA TGCAAGAGTA
GACTTGGGTG GGTGACATTG TAATTAGTCC CTGTTTTCTC ACCTATATTA TTCACATGTG ACCTTCTAGA TGTAGTCTTG
TAATCAGTAT GTCTTACATG AAGACAGCTT AGAGATTTAT TCGTGCTAGA AAAAAAAAAG GTTCTGCGTG TATAAAGCTG
TTGCAGGAAA TATGTTACAC TCCATGGCAT GCAGCAGGAC ACAACTCATG AACTATGCTG CACCCAAGGA AGTTTATATA
TTTGGTTGCT TCTCAGTAGT TTATCTGATC AACAATGTGT TAGAAGCCAT TGCAGTTGTA TGGTTTCTTC ACTCGATCAG
TTTATACCAC TGCTTACTGT CTGTCATAAT CCTGAAACCC TGTGGGCTGT CGCACTTATA AAGCAACTTA AGTTTGTTCA
AAAGTAGCAG ATTAACTATC ACTTTACATG ATTATTGTTA TGCTGACGTT ACAAGTGAGA ATTAATACTT AATGATTCTG
TGCCAATATT AATGCAGTGG AACGCCTTAC CGTTGAAGAG TTTGTGAACC ATCCATTTCT CGCTGAACAT GCTTTGGAGA
GAACCTTGAG GTAATATATT CTTTGCTATA GTTTTACTTC TACAGCATCA CGTGACATGT TTGATATTCT GTATTGCATT
GACAGCCGGA CACCATCGGA CATAAGAGAT GGCTTTCCAT TCATTAATAG CAGTCCTACG AGACCTTCAA GCCAAAGTTC
TCAGGAAGAT TGTATGCCTT TTCCTTTGGA TGATGAGTCA ACTGGACAGG ATGAAGGTCC TGTTTCTGAT AGTAAGAGTG
CAATAAAATC CTATGGGTTT GCCACGAGTA AAAGGCTTGA TAAAACTTCA GGTCAGAGTC CAACGAAACA TTCAAGTCTG
GTCTCTAAAT ATATTAGGGG AAATAATTAC GCATCTAGTA GTCAACGCCT GGACCATCCT AGGAGAATCA AGGAAAACAA
GGGTGATGAA GGGCACAACC CTAAAGGTGG TTATCCAGAA GGTATTGCAG TCTGTTGTGA CTATCACATG TTTCATTATA
ATTGTGAAAA AGTTCTTACT AAATTTGTTA TTTCCTTACT TGTAAATGTA GATTCCCCTA TCATTGATTC ATTAGAGTTT
GTAGATCAGG AATATGTCTT TGTGCACCCA GAGGGATCCT CCTCTTCGAT GAATGACTCC CGACAGCGCA CCATGCCATC
AAAACTTGAC AGTTCTTCTC TTTCACCACC GAAGTTATTA ACTGCTGTGA GTGCACCAAG GCCAATACAT GGCATGGCAA
TTAACAGACA GCAATCTGGT GGAACTGGTA GCTTGGACAG TCACTGCTCT CCAGTATCTG GTACTTCACA AGGATCTGCA
GATCTCAACG ATGCTATGGA TCAACCACCA TCTGATTGTC TGACCAGGGT TAGATTATTG GAGCAGTATG CGTCTACCAT
AGCAGAATTG GTGAAAGAAA AGGTAACTTT CTTCTCAGTG GACTCAAATT TCCTTGCCTC CTATTTGACT TCCTTCTGTT
TAACATTGAC CAAAGTTCTC ATCCTTTTGA TATGTTTGGA TTCTCTGTCC AAAACATTGT GGTGAAGCTT ATTTACCATA
TAAACTAAGG TCTTGTGTTT CATTCATCTG CCTGAGACAA GTCTTTATCT ATGCAATTGC AAATGCTAAC CATGCTTTTG
TTTTGCTGAT CAACCACCCA AACTTTTGTA GATTAAAGAT GCCAAGCACT TAGAGGGATT CTCGATTCAG CTAGTTGTTC
TTGCAACCTG GAAGCAAGCA ATTTACATCT GCACTTCTTA TGCATCTTCT GCCACAAGAG AGAATCCTTC CCATGATGTC
ACCGCGAAGG GTTTTGGCTC AAATGCTCCC CATTTGCTTG CAAACTCTCA ACTGTTATAT GATACATGCA TGGAGATAGA
GAGTCAGTTT TTGGTTCAAA TGGAATATGC TGAAGAACTT GCCAACACTA TAGGACAGAC AGTTGGTATG TTACCTTGCC
TAGGAGCTTT AAATCGTTGG TTGAACTTCT TGAATGCTGA ATTGCTGATT GTGAGCTTAT GCTTGCAGAT GCTACAGAAA
TGCCAGATGC GATAGAAATC ATATTTCAGA CCGCGCTTAA CCTGGGAAGA CATGGTGGTG TAAGTCAATA TCAAGCACAC
TGTCTTACAT AGCAGAACGA AAGCTTGGTG TGCACTCTTA TCCCACTCTT TTTGTGTGTT TTGTTATGCT AAATTGCAGG
TTGATGAGAT GATGGGGAAA TCAGCATCTG CCATGGTGCT GTACTCGAAG GCAGTATCCA TGCTGCGCTT TCTCCTGACT
GAGGCACCGT CACTCGCCCT GAACCCCGCT CTGTCCCTAA CAAGAGATGA TCGACGCCGC CTGCGCACAT ACATTGAAGC
CGTTAACGCT AGGCTCGTCC CGTTGCAATA CCAGCGGCAC TGACCGCTCA CCTGTACAAT ATTCTTTCAT CCTGTACATA
TATTCGTTGG CCCAAACGAG GGCGTGTAAG ATATGTCATG TCTGAGAACG TGCTCCGATT AGGGAGAAGT AGCGAAAAAT
CCAGTGTAAC TTGCCCAAAC TGCCTACTGT AACGTGAGCT CGGTGTGCTT GCATGGTACG CCTGATTATC AGGCAGCTCA
GGTTGGCAGC TGAAGGCCCG ACCATGGTCG TTTGTGGACA TGTAAAGCAG ACTGCTACCT CGATGGTTTG TTCATTAAAA
TTTGGGCTTT TACACTGCAT ATGTTGTCCA AGTCATCGTT GATTTTGAGT TGTGCTGTCT AACTTGTCCA AGTCCTGTTA
ATTATGAATT GAATTTGTGT GTGTGTTTTT TCTC

Locus: Os03g0268200

Loading...

Locus: Os03g0268200

Loading...