Os03t0268200-04

Locus

Os03g0268200

Description

Similar to Protein kinase domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ATG1A

CGSNL Gene Name

AUTOPHAGY ASSOCIATED GENE 1A

Oryzabase Gene Symbol Synonym(s)

OsATG1a

Oryzabase Gene Name Synonym(s)

autophagy 1a

Transcript Evidence

AK099658 (DDBJ, Best hit)

Protein Evidence

Q10NJ0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Serine/threonine-protein kinase, C-terminal (IPR022708)

Full-length cDNA

J013066E23 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0268200-04)

RiceXPro (AK099658)

Others

Oryzabase (9632)

KEGG (Os03t0268200-04 (EC:2.7.11.1))

Transcript

2562 bp

>Os03t0268200-04 Similar to Protein kinase domain containing protein, expressed.
TGTTCCGCGCGGCGAGATAATTCGGTTGCTTCTCCCCGCGGCCGCGGCGGCATCTCTCCC
GGCGGCGGCGGAGCTCACGTCCTTCGCGGCGAACTGCGCTCCAGGCAGCGGGACCAGAGG
GGATGGGGGACCGCGCCGCGGGGAGCGGCGGCGGGGGAGGGGGAGGAAGCGGCGTGCGGA
GGGTAGGGGACTACGTGCTGGTGCGGCAGATCGGGTCGGGGGCGTACGCGCGGGTCTGGC
TCGGGAAGCACCGCACGCGGGGCACGGAGGTGGCCTTGAAGGAGATCGCCGTGGAGCGGC
TTAGCAGCAAGCTCCGCGAGAGCCTCCTCTCCGAGGTCGACATCCTCCGGCGCATCCGTC
ATCCCAACGTCATCGCCCTCCACGAGTCCATCAGGGATGGTGGGAAAATATATCTTGTAT
TAGAGTACTGTCGAGGTGGTGACTTACACTCATACCTTCAGCAGCATAAAAGGGTTTCTG
AAACAGTTGCTAAGCATTTCATCCAGCAGCTAGCATCTGGTCTGCAGATGCTGCGTGAAA
ACAACGTGGTTCATCGAGATCTAAAACCACAGAACATTCTTCTAGTTGCAAATAATGAAA
ATTCCCTCTTGAAGATTGCGGACTTTGGATTTGCAAAGTTTTTAGAACCTTCTTCTCTGG
CTGAAACACTTTGCGGTTCACCGCTTTACATGGCTCCAGAAGTCATGCAAGCTCAGAAGT
ATGATGCAAAGGCAGATTTGTGGAGTGTTGGTATAATTCTATATCAACTTGTTACCGGAT
CTCCTCCTTTTACCGGGGATAGTCAAATCCAGTTGCTGAGAAATATACTCAATACACGAG
AAATACGATTTCCATCTGATTGCGACTTGAGCCATGGCTGCATTGACTTATGCAGAAAGT
TACTGCGAATCAATTCAGTGGAACGCCTTACCGTTGAAGAGTTTGTGAACCATCCATTTC
TCGCTGAACATGCTTTGGAGAGAACCTTGAGCCGGACACCATCGGACATAAGAGATGGCT
TTCCATTCATTAATAGCAGTCCTACGAGACCTTCAAGCCAAAGTTCTCAGGAAGATTGTA
TGCCTTTTCCTTTGGATGATGAGTCAACTGGACAGGATGAAGGTCCTGTTTCTGATAGTA
AGAGTGCAATAAAATCCTATGGGTTTGCCACGAGTAAAAGGCTTGATAAAACTTCAGGTC
AGAGTCCAACGAAACATTCAAGTCTGGTCTCTAAATATATTAGGGGAAATAATTACGCAT
CTAGTAGTCAACGCCTGGACCATCCTAGGAGAATCAAGGAAAACAAGGGTGATGAAGGGC
ACAACCCTAAAGGTGGTTATCCAGAAGATTCCCCTATCATTGATTCATTAGAGTTTGTAG
ATCAGGAATATGTCTTTGTGCACCCAGAGGGATCCTCCTCTTCGATGAATGACTCCCGAC
AGCGCACCATGCCATCAAAACTTGACAGTTCTTCTCTTTCACCACCGAAGTTATTAACTG
CTGTGAGTGCACCAAGGCCAATACATGGCATGGCAATTAACAGACAGCAATCTGGTGGAA
CTGGTAGCTTGGACAGTCACTGCTCTCCAGTATCTGGTACTTCACAAGGATCTGCAGATC
TCAACGATGCTATGGATCAACCACCATCTGATTGTCTGACCAGGGTTAGATTATTGGAGC
AGTATGCGTCTACCATAGCAGAATTGGTGAAAGAAAAGATTAAAGATGCCAAGCACTTAG
AGGGATTCTCGATTCAGCTAGTTGTTCTTGCAACCTGGAAGCAAGCAATTTACATCTGCA
CTTCTTATGCATCTTCTGCCACAAGAGAGAATCCTTCCCATGATGTCACCGCGAAGGGTT
TTGGCTCAAATGCTCCCCATTTGCTTGCAAACTCTCAACTGTTATATGATACATGCATGG
AGATAGAGAGTCAGTTTTTGGTTCAAATGGAATATGCTGAAGAACTTGCCAACACTATAG
GACAGACAGTTGATGCTACAGAAATGCCAGATGCGATAGAAATCATATTTCAGACCGCGC
TTAACCTGGGAAGACATGGTGGTGTTGATGAGATGATGGGGAAATCAGCATCTGCCATGG
TGCTGTACTCGAAGGCAGTATCCATGCTGCGCTTTCTCCTGACTGAGGCACCGTCACTCG
CCCTGAACCCCGCTCTGTCCCTAACAAGAGATGATCGACGCCGCCTGCGCACATACATTG
AAGCCGTTAACGCTAGGCTCGTCCCGTTGCAATACCAGCGGCACTGACCGCTCACCTGTA
CAATATTCTTTCATCCTGTACATATATTCGTTGGCCCAAACGAGGGCGTGTAAGATATGT
CATGTCTGAGAACGTGCTCCGATTAGGGAGAAGTAGCGAAAAATCCAGTGTAACTTGCCC
AAACTGCCTACTGTAACGTGAGCTCGGTGTGCTTGCATGGTACGCCTGATTATCAGGCAG
CTCAGGTTGGCAGCTGAAGGCCCGACCATGGTCGTTTGTGGACATGTAAAGCAGACTGCT
ACCTCGATGGTTTGTTCATTAAAATTTGGGCTTTTACACTGC

CDS

2145 bp

>Os03t0268200-04 Similar to Protein kinase domain containing protein, expressed.
ATGGGGGACCGCGCCGCGGGGAGCGGCGGCGGGGGAGGGGGAGGAAGCGGCGTGCGGAGG
GTAGGGGACTACGTGCTGGTGCGGCAGATCGGGTCGGGGGCGTACGCGCGGGTCTGGCTC
GGGAAGCACCGCACGCGGGGCACGGAGGTGGCCTTGAAGGAGATCGCCGTGGAGCGGCTT
AGCAGCAAGCTCCGCGAGAGCCTCCTCTCCGAGGTCGACATCCTCCGGCGCATCCGTCAT
CCCAACGTCATCGCCCTCCACGAGTCCATCAGGGATGGTGGGAAAATATATCTTGTATTA
GAGTACTGTCGAGGTGGTGACTTACACTCATACCTTCAGCAGCATAAAAGGGTTTCTGAA
ACAGTTGCTAAGCATTTCATCCAGCAGCTAGCATCTGGTCTGCAGATGCTGCGTGAAAAC
AACGTGGTTCATCGAGATCTAAAACCACAGAACATTCTTCTAGTTGCAAATAATGAAAAT
TCCCTCTTGAAGATTGCGGACTTTGGATTTGCAAAGTTTTTAGAACCTTCTTCTCTGGCT
GAAACACTTTGCGGTTCACCGCTTTACATGGCTCCAGAAGTCATGCAAGCTCAGAAGTAT
GATGCAAAGGCAGATTTGTGGAGTGTTGGTATAATTCTATATCAACTTGTTACCGGATCT
CCTCCTTTTACCGGGGATAGTCAAATCCAGTTGCTGAGAAATATACTCAATACACGAGAA
ATACGATTTCCATCTGATTGCGACTTGAGCCATGGCTGCATTGACTTATGCAGAAAGTTA
CTGCGAATCAATTCAGTGGAACGCCTTACCGTTGAAGAGTTTGTGAACCATCCATTTCTC
GCTGAACATGCTTTGGAGAGAACCTTGAGCCGGACACCATCGGACATAAGAGATGGCTTT
CCATTCATTAATAGCAGTCCTACGAGACCTTCAAGCCAAAGTTCTCAGGAAGATTGTATG
CCTTTTCCTTTGGATGATGAGTCAACTGGACAGGATGAAGGTCCTGTTTCTGATAGTAAG
AGTGCAATAAAATCCTATGGGTTTGCCACGAGTAAAAGGCTTGATAAAACTTCAGGTCAG
AGTCCAACGAAACATTCAAGTCTGGTCTCTAAATATATTAGGGGAAATAATTACGCATCT
AGTAGTCAACGCCTGGACCATCCTAGGAGAATCAAGGAAAACAAGGGTGATGAAGGGCAC
AACCCTAAAGGTGGTTATCCAGAAGATTCCCCTATCATTGATTCATTAGAGTTTGTAGAT
CAGGAATATGTCTTTGTGCACCCAGAGGGATCCTCCTCTTCGATGAATGACTCCCGACAG
CGCACCATGCCATCAAAACTTGACAGTTCTTCTCTTTCACCACCGAAGTTATTAACTGCT
GTGAGTGCACCAAGGCCAATACATGGCATGGCAATTAACAGACAGCAATCTGGTGGAACT
GGTAGCTTGGACAGTCACTGCTCTCCAGTATCTGGTACTTCACAAGGATCTGCAGATCTC
AACGATGCTATGGATCAACCACCATCTGATTGTCTGACCAGGGTTAGATTATTGGAGCAG
TATGCGTCTACCATAGCAGAATTGGTGAAAGAAAAGATTAAAGATGCCAAGCACTTAGAG
GGATTCTCGATTCAGCTAGTTGTTCTTGCAACCTGGAAGCAAGCAATTTACATCTGCACT
TCTTATGCATCTTCTGCCACAAGAGAGAATCCTTCCCATGATGTCACCGCGAAGGGTTTT
GGCTCAAATGCTCCCCATTTGCTTGCAAACTCTCAACTGTTATATGATACATGCATGGAG
ATAGAGAGTCAGTTTTTGGTTCAAATGGAATATGCTGAAGAACTTGCCAACACTATAGGA
CAGACAGTTGATGCTACAGAAATGCCAGATGCGATAGAAATCATATTTCAGACCGCGCTT
AACCTGGGAAGACATGGTGGTGTTGATGAGATGATGGGGAAATCAGCATCTGCCATGGTG
CTGTACTCGAAGGCAGTATCCATGCTGCGCTTTCTCCTGACTGAGGCACCGTCACTCGCC
CTGAACCCCGCTCTGTCCCTAACAAGAGATGATCGACGCCGCCTGCGCACATACATTGAA
GCCGTTAACGCTAGGCTCGTCCCGTTGCAATACCAGCGGCACTGA

Protein

714 aa

>Os03t0268200-04 Similar to Protein kinase domain containing protein, expressed.
MGDRAAGSGGGGGGGSGVRRVGDYVLVRQIGSGAYARVWLGKHRTRGTEVALKEIAVERL
SSKLRESLLSEVDILRRIRHPNVIALHESIRDGGKIYLVLEYCRGGDLHSYLQQHKRVSE
TVAKHFIQQLASGLQMLRENNVVHRDLKPQNILLVANNENSLLKIADFGFAKFLEPSSLA
ETLCGSPLYMAPEVMQAQKYDAKADLWSVGIILYQLVTGSPPFTGDSQIQLLRNILNTRE
IRFPSDCDLSHGCIDLCRKLLRINSVERLTVEEFVNHPFLAEHALERTLSRTPSDIRDGF
PFINSSPTRPSSQSSQEDCMPFPLDDESTGQDEGPVSDSKSAIKSYGFATSKRLDKTSGQ
SPTKHSSLVSKYIRGNNYASSSQRLDHPRRIKENKGDEGHNPKGGYPEDSPIIDSLEFVD
QEYVFVHPEGSSSSMNDSRQRTMPSKLDSSSLSPPKLLTAVSAPRPIHGMAINRQQSGGT
GSLDSHCSPVSGTSQGSADLNDAMDQPPSDCLTRVRLLEQYASTIAELVKEKIKDAKHLE
GFSIQLVVLATWKQAIYICTSYASSATRENPSHDVTAKGFGSNAPHLLANSQLLYDTCME
IESQFLVQMEYAEELANTIGQTVDATEMPDAIEIIFQTALNLGRHGGVDEMMGKSASAMV
LYSKAVSMLRFLLTEAPSLALNPALSLTRDDRRRLRTYIEAVNARLVPLQYQRH*

5'UTR

chr03:8901820..8901941 (- strand) : 122 bp

CDS

chr03:8901547..8901819 (- strand) : 273 bp

chr03:8900861..8900978 (- strand) : 118 bp

chr03:8900713..8900771 (- strand) : 59 bp

chr03:8900508..8900572 (- strand) : 65 bp

chr03:8899559..8899652 (- strand) : 94 bp

chr03:8899387..8899467 (- strand) : 81 bp

chr03:8899199..8899304 (- strand) : 106 bp

chr03:8898450..8898522 (- strand) : 73 bp

chr03:8898019..8898374 (- strand) : 356 bp

chr03:8897558..8897928 (- strand) : 371 bp

chr03:8897035..8897308 (- strand) : 274 bp

chr03:8896881..8896951 (- strand) : 71 bp

chr03:8896577..8896780 (- strand) : 204 bp

3'UTR

chr03:8896282..8896576 (- strand) : 295 bp

FASTA

>Os03t0268200-04 class=Sequence position=chr03:8896282..8901941 (- strand)
TGTTCCGCGC GGCGAGATAA TTCGGTTGCT TCTCCCCGCG GCCGCGGCGG CATCTCTCCC GGCGGCGGCG GAGCTCACGT
CCTTCGCGGC GAACTGCGCT CCAGGCAGCG GGACCAGAGG GGATGGGGGA CCGCGCCGCG GGGAGCGGCG GCGGGGGAGG
GGGAGGAAGC GGCGTGCGGA GGGTAGGGGA CTACGTGCTG GTGCGGCAGA TCGGGTCGGG GGCGTACGCG CGGGTCTGGC
TCGGGAAGCA CCGCACGCGG GGCACGGAGG TGGCCTTGAA GGAGATCGCC GTGGAGCGGC TTAGCAGCAA GCTCCGCGAG
AGCCTCCTCT CCGAGGTCGA CATCCTCCGG CGCATCCGTC ATCCCAACGT CATCGCCCTC CACGAGTCCA TCAGGGTACC
CCGATCCTCG GATCAACGCC CTTCTACTGT TTATATTTTG CGCAATTGCG TTCGATTTGT TAGGATTTCA TGCGGACGGC
GACTGTTTAT AAACCTCGGA TGAATAAAAT CGGGAGTTCT TATAGTCTCT CTTTTAGTTG AATTCTTCTG AGCTTTCTTG
GTATTCAGAT GCCTCAAGCA AAGGAGAACT CATTGGGCTT GACGTTCATT TGGGTGGTGA TACTATGCAA AGTTTTAACT
TAATGCTAGT ACCATAGCGT AAGTTGTTTA ACTTTGGATG TTTGTTCGCT GGCTGTGGAA GCAAAACATT AAAATTCCAA
ATTTGGTAAC TTGTTTGTTT TGGATATATT TTCTGGTGGA ATTTAGGAAA CTATACCATT AGTTGTTCCC TCCTTAGAGT
TCAAAAGCAT ACCTAACATG TTTAATTATG CCTCCGATAT TAATATTTCT AGGTGTTCCA CGAAAGGGAA GCTTCCCTCT
AGGGAGATTG TTGGACATAA TTATTTCTTC ACTCTCATAT CTAACTATTA TTTGCGTATC TCTTTGTTAT TTGATGATTT
TAGGATGGTG GGAAAATATA TCTTGTATTA GAGTACTGTC GAGGTGGTGA CTTACACTCA TACCTTCAGC AGCATAAAAG
GGTTTCTGAA ACAGTTGCTA AGCATTTCAT CCAGCAGCTA GGCAAGCACT TTCTCAGACC CTCAGTGTCT TGCACTATTT
ATTGCTTTAT CTCTCCCCAG AGCCAAAATC ACATTCTCTT CTTTATGCAG CATCTGGTCT GCAGATGCTG CGTGAAAACA
ACGTGGTTCA TCGAGATCTA AAACCACAGG TTAAATTATT TAATTTACTG TTATTGAGTG GATATTTCCA TTATATCTTC
ATATTTAATG ACAAAGAATT GATGAAAGAA ACGGAATTTC CTGACATTTT GTTTTGTTTT CTATCCTGAA TTTGTGGCTG
TTCAAATAGA ACATTCTTCT AGTTGCAAAT AATGAAAATT CCCTCTTGAA GATTGCGGAC TTTGGATTTG CAAAGTAAGT
TACTTATGTT TGATTGCTTT TATTTTGGAG TTATATTATC TTATTTTCCA CATGGCCTTT TTTATTGAGT TTATCAGCAA
TGAGTTTGAT ACCTGGTTTA AGAATCCCCT AATAGGTCTG TAGAAATCGC TCCTACCTGA AATGAAATTG CAGTATTGTG
AAAGAAACGG TGTTGTGCAT TTTAAAATGG AATAACTTCT CAAGAAGTTC TGAAAAAAAT ACAGTCAATT TGCACTATTT
CAAAAGAAAA GGTGCATCAT TTGAAAGTCT CATCTTCATG TCTTGAAAGA TGTTAGAGAC ATTCCATTTA AAGAATGAAA
TATTATGTGC ATCACTTTTT AGGCCCCCTT CAGGATTTGG CTCCACAACT ACAGCATGCC TTCATTGTTA CAAAAAAATA
TTTCATGTAC CAATACACCT ATGTCGCATA TGTATTACTC CAATTAAGCT ATCATTGTTA CAAAAAAAAA AGCTATCTTG
AGTCCAATTA ATTCTCTACA CTCAATTCTA CTTTTTTTTA TTGAACAGTC CTACTCCGTA ATGTAATGTC CTTTGAATTC
ACACAGAGTT TTACACAAAA ATCTGTGCAT AAAAGCTAAG TACGAAACAT TCTTGAGGAC AACTAGATAA GTATCGTGCA
GGGAAAGAGA ATAAGATCAT GTTGCTTTGT GCTTGATCCT GTGTTTCTCT GCTTCCTTGC ATATTTAATT ACAGCCATGA
CAAAATTGGC ACCTCAGCTT TCTCTCTGCT TCTCATTCAT CGATGGTTGG ATCAAGTGAG GCTTGGTGGG AGGGTTAGAC
GCGGATAGTA TCAGAAATGT GTACTTACCT TTTCTATTCT TGCAAGCAGG TTTTTAGAAC CTTCTTCTCT GGCTGAAACA
CTTTGCGGTT CACCGCTTTA CATGGCTCCA GAAGTCATGC AAGCTCAGAA GTATGATGCA AAGGTCAGGG CTTTTTTCTG
CTTCCTTGTG AGCTTTATCA TGTACTTTTA CCTGTTCTTG ACTCGTGCTT CATGCCCGAT TTCTGACAGA ACAGGCAGAT
TTGTGGAGTG TTGGTATAAT TCTATATCAA CTTGTTACCG GATCTCCTCC TTTTACCGGG GATAGTCAAA TCCAGGTTTA
TTCAAATTTT CCACATGACC TGATTTCTAG TGCATTATTA AATCAGGCTA CTACTGAAAA ATGTTATTTC CCATCAGTTG
CTGAGAAATA TACTCAATAC ACGAGAAATA CGATTTCCAT CTGATTGCGA CTTGAGCCAT GGCTGCATTG ACTTATGCAG
AAAGTTACTG CGAATCAATT CAGGTACGAA TCCTCTGCTA CACTTATGTA TAGTTATATA TAAAAACAAG TTTCATAAGA
CTTCCACATG TCATTATTTT TTCTTACATC CTTACCAGGA AGGGTAAAAT TTTCCAGAAT TATACTGTGA CATGACTGAT
ATTACGCCAA AGAAAAACAT GAATGACTAT CATGCAAGAG TAGACTTGGG TGGGTGACAT TGTAATTAGT CCCTGTTTTC
TCACCTATAT TATTCACATG TGACCTTCTA GATGTAGTCT TGTAATCAGT ATGTCTTACA TGAAGACAGC TTAGAGATTT
ATTCGTGCTA GAAAAAAAAA AGGTTCTGCG TGTATAAAGC TGTTGCAGGA AATATGTTAC ACTCCATGGC ATGCAGCAGG
ACACAACTCA TGAACTATGC TGCACCCAAG GAAGTTTATA TATTTGGTTG CTTCTCAGTA GTTTATCTGA TCAACAATGT
GTTAGAAGCC ATTGCAGTTG TATGGTTTCT TCACTCGATC AGTTTATACC ACTGCTTACT GTCTGTCATA ATCCTGAAAC
CCTGTGGGCT GTCGCACTTA TAAAGCAACT TAAGTTTGTT CAAAAGTAGC AGATTAACTA TCACTTTACA TGATTATTGT
TATGCTGACG TTACAAGTGA GAATTAATAC TTAATGATTC TGTGCCAATA TTAATGCAGT GGAACGCCTT ACCGTTGAAG
AGTTTGTGAA CCATCCATTT CTCGCTGAAC ATGCTTTGGA GAGAACCTTG AGGTAATATA TTCTTTGCTA TAGTTTTACT
TCTACAGCAT CACGTGACAT GTTTGATATT CTGTATTGCA TTGACAGCCG GACACCATCG GACATAAGAG ATGGCTTTCC
ATTCATTAAT AGCAGTCCTA CGAGACCTTC AAGCCAAAGT TCTCAGGAAG ATTGTATGCC TTTTCCTTTG GATGATGAGT
CAACTGGACA GGATGAAGGT CCTGTTTCTG ATAGTAAGAG TGCAATAAAA TCCTATGGGT TTGCCACGAG TAAAAGGCTT
GATAAAACTT CAGGTCAGAG TCCAACGAAA CATTCAAGTC TGGTCTCTAA ATATATTAGG GGAAATAATT ACGCATCTAG
TAGTCAACGC CTGGACCATC CTAGGAGAAT CAAGGAAAAC AAGGGTGATG AAGGGCACAA CCCTAAAGGT GGTTATCCAG
AAGGTATTGC AGTCTGTTGT GACTATCACA TGTTTCATTA TAATTGTGAA AAAGTTCTTA CTAAATTTGT TATTTCCTTA
CTTGTAAATG TAGATTCCCC TATCATTGAT TCATTAGAGT TTGTAGATCA GGAATATGTC TTTGTGCACC CAGAGGGATC
CTCCTCTTCG ATGAATGACT CCCGACAGCG CACCATGCCA TCAAAACTTG ACAGTTCTTC TCTTTCACCA CCGAAGTTAT
TAACTGCTGT GAGTGCACCA AGGCCAATAC ATGGCATGGC AATTAACAGA CAGCAATCTG GTGGAACTGG TAGCTTGGAC
AGTCACTGCT CTCCAGTATC TGGTACTTCA CAAGGATCTG CAGATCTCAA CGATGCTATG GATCAACCAC CATCTGATTG
TCTGACCAGG GTTAGATTAT TGGAGCAGTA TGCGTCTACC ATAGCAGAAT TGGTGAAAGA AAAGGTAACT TTCTTCTCAG
TGGACTCAAA TTTCCTTGCC TCCTATTTGA CTTCCTTCTG TTTAACATTG ACCAAAGTTC TCATCCTTTT GATATGTTTG
GATTCTCTGT CCAAAACATT GTGGTGAAGC TTATTTACCA TATAAACTAA GGTCTTGTGT TTCATTCATC TGCCTGAGAC
AAGTCTTTAT CTATGCAATT GCAAATGCTA ACCATGCTTT TGTTTTGCTG ATCAACCACC CAAACTTTTG TAGATTAAAG
ATGCCAAGCA CTTAGAGGGA TTCTCGATTC AGCTAGTTGT TCTTGCAACC TGGAAGCAAG CAATTTACAT CTGCACTTCT
TATGCATCTT CTGCCACAAG AGAGAATCCT TCCCATGATG TCACCGCGAA GGGTTTTGGC TCAAATGCTC CCCATTTGCT
TGCAAACTCT CAACTGTTAT ATGATACATG CATGGAGATA GAGAGTCAGT TTTTGGTTCA AATGGAATAT GCTGAAGAAC
TTGCCAACAC TATAGGACAG ACAGTTGGTA TGTTACCTTG CCTAGGAGCT TTAAATCGTT GGTTGAACTT CTTGAATGCT
GAATTGCTGA TTGTGAGCTT ATGCTTGCAG ATGCTACAGA AATGCCAGAT GCGATAGAAA TCATATTTCA GACCGCGCTT
AACCTGGGAA GACATGGTGG TGTAAGTCAA TATCAAGCAC ACTGTCTTAC ATAGCAGAAC GAAAGCTTGG TGTGCACTCT
TATCCCACTC TTTTTGTGTG TTTTGTTATG CTAAATTGCA GGTTGATGAG ATGATGGGGA AATCAGCATC TGCCATGGTG
CTGTACTCGA AGGCAGTATC CATGCTGCGC TTTCTCCTGA CTGAGGCACC GTCACTCGCC CTGAACCCCG CTCTGTCCCT
AACAAGAGAT GATCGACGCC GCCTGCGCAC ATACATTGAA GCCGTTAACG CTAGGCTCGT CCCGTTGCAA TACCAGCGGC
ACTGACCGCT CACCTGTACA ATATTCTTTC ATCCTGTACA TATATTCGTT GGCCCAAACG AGGGCGTGTA AGATATGTCA
TGTCTGAGAA CGTGCTCCGA TTAGGGAGAA GTAGCGAAAA ATCCAGTGTA ACTTGCCCAA ACTGCCTACT GTAACGTGAG
CTCGGTGTGC TTGCATGGTA CGCCTGATTA TCAGGCAGCT CAGGTTGGCA GCTGAAGGCC CGACCATGGT CGTTTGTGGA
CATGTAAAGC AGACTGCTAC CTCGATGGTT TGTTCATTAA AATTTGGGCT TTTACACTGC 

Locus: Os03g0268200

Loading...

Locus: Os03g0268200

Loading...