Os03t0268200-05

Locus

Os03g0268200

Description

Similar to Protein kinase domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ATG1A

CGSNL Gene Name

AUTOPHAGY ASSOCIATED GENE 1A

Oryzabase Gene Symbol Synonym(s)

OsATG1a

Oryzabase Gene Name Synonym(s)

autophagy 1a

Transcript Evidence

AK058854 (DDBJ, Best hit)

Protein Evidence

Q10NJ0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Functional domain (InterPro)

Serine/threonine-protein kinase, C-terminal (IPR022708)

Full-length cDNA

001-005-B01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0268200-05)

RiceXPro (AK058854)

Others

Oryzabase (9632)

KEGG (Os03t0268200-05)

Transcript

1007 bp

>Os03t0268200-05 Similar to Protein kinase domain containing protein, expressed.
GATATGTTTGGATTCTCTGTCCAAAACATTGTGGTGAAGCTTATTTACCATATAAACTAA
GGTCTTGTGTTTCATTCATCTGCCTGAGACAAGTCTTTATCTATGCAATTGCAAATGCTA
ACCATGCTTTTGTTTTGCTGATCAACCACCCAAACTTTTGTAGATTAAAGATGCCAAGCA
CTTAGAGGGATTCTCGATTCAGCTAGTTGTTCTTGCAACCTGGAAGCAAGCAATTTACAT
CTGCACTTCTTATGCATCTTCTGCCACAAGAGAGAATCCTTCCCATGATGTCACCGCGAA
GGGTTTTGGCTCAAATGCTCCCCATTTGCTTGCAAACTCTCAACTGTTATATGATACATG
CATGGAGATAGAGAGTCAGTTTTTGGTTCAAATGGAATATGCTGAAGAACTTGCCAACAC
TATAGGACAGACAGTTGATGCTACAGAAATGCCAGATGCGATAGAAATCATATTTCAGAC
CGCGCTTAACCTGGGAAGACATGGTGGTGTTGATGAGATGATGGGGAAATCAGCATCTGC
CATGGTGCTGTACTCGAAGGCAGTATCCATGCTGCGCTTTCTCCTGACTGAGGCACCGTC
ACTCGCCCTGAACCCCGCTCTGTCCCTAACAAGAGATGATCGACGCCGCCTGCGCACATA
CATTGAAGCCGTTAACGCTAGGCTCGTCCCGTTGCAATACCAGCGGCACTGACCGCTCAC
CTGTACAATATTCTTTCATCCTGTACATATATTCGTTGGCCCAAACGAGGGCGTGTAAGA
TATGTCATGTCTGAGAACGTGCTCCGATTAGGGAGAAGTAGCGAAAAATCCAGTGTAACT
TGCCCAAACTGCCTACTGTAACGTGAGCTCGGTGTGCTTGCATGGTACGCCTGATTATCA
GGCAGCTCAGGTTGGCAGCTGAAGGCCCGACCATGGTCGTTTGTGGACATGTAAAGCAGA
CTGCTACCTCGATGGTTTGTTCATTAAAATTTGGGCTTTTACACTGC

CDS

549 bp

>Os03t0268200-05 Similar to Protein kinase domain containing protein, expressed.
ATTAAAGATGCCAAGCACTTAGAGGGATTCTCGATTCAGCTAGTTGTTCTTGCAACCTGG
AAGCAAGCAATTTACATCTGCACTTCTTATGCATCTTCTGCCACAAGAGAGAATCCTTCC
CATGATGTCACCGCGAAGGGTTTTGGCTCAAATGCTCCCCATTTGCTTGCAAACTCTCAA
CTGTTATATGATACATGCATGGAGATAGAGAGTCAGTTTTTGGTTCAAATGGAATATGCT
GAAGAACTTGCCAACACTATAGGACAGACAGTTGATGCTACAGAAATGCCAGATGCGATA
GAAATCATATTTCAGACCGCGCTTAACCTGGGAAGACATGGTGGTGTTGATGAGATGATG
GGGAAATCAGCATCTGCCATGGTGCTGTACTCGAAGGCAGTATCCATGCTGCGCTTTCTC
CTGACTGAGGCACCGTCACTCGCCCTGAACCCCGCTCTGTCCCTAACAAGAGATGATCGA
CGCCGCCTGCGCACATACATTGAAGCCGTTAACGCTAGGCTCGTCCCGTTGCAATACCAG
CGGCACTGA

Protein

182 aa

>Os03t0268200-05 Similar to Protein kinase domain containing protein, expressed.
IKDAKHLEGFSIQLVVLATWKQAIYICTSYASSATRENPSHDVTAKGFGSNAPHLLANSQ
LLYDTCMEIESQFLVQMEYAEELANTIGQTVDATEMPDAIEIIFQTALNLGRHGGVDEMM
GKSASAMVLYSKAVSMLRFLLTEAPSLALNPALSLTRDDRRRLRTYIEAVNARLVPLQYQ
RH*

5'UTR

chr03:8897309..8897471 (- strand) : 163 bp

CDS

chr03:8897035..8897308 (- strand) : 274 bp

chr03:8896881..8896951 (- strand) : 71 bp

chr03:8896577..8896780 (- strand) : 204 bp

3'UTR

chr03:8896282..8896576 (- strand) : 295 bp

FASTA

>Os03t0268200-05 class=Sequence position=chr03:8896282..8897471 (- strand)
GATATGTTTG GATTCTCTGT CCAAAACATT GTGGTGAAGC TTATTTACCA TATAAACTAA GGTCTTGTGT TTCATTCATC
TGCCTGAGAC AAGTCTTTAT CTATGCAATT GCAAATGCTA ACCATGCTTT TGTTTTGCTG ATCAACCACC CAAACTTTTG
TAGATTAAAG ATGCCAAGCA CTTAGAGGGA TTCTCGATTC AGCTAGTTGT TCTTGCAACC TGGAAGCAAG CAATTTACAT
CTGCACTTCT TATGCATCTT CTGCCACAAG AGAGAATCCT TCCCATGATG TCACCGCGAA GGGTTTTGGC TCAAATGCTC
CCCATTTGCT TGCAAACTCT CAACTGTTAT ATGATACATG CATGGAGATA GAGAGTCAGT TTTTGGTTCA AATGGAATAT
GCTGAAGAAC TTGCCAACAC TATAGGACAG ACAGTTGGTA TGTTACCTTG CCTAGGAGCT TTAAATCGTT GGTTGAACTT
CTTGAATGCT GAATTGCTGA TTGTGAGCTT ATGCTTGCAG ATGCTACAGA AATGCCAGAT GCGATAGAAA TCATATTTCA
GACCGCGCTT AACCTGGGAA GACATGGTGG TGTAAGTCAA TATCAAGCAC ACTGTCTTAC ATAGCAGAAC GAAAGCTTGG
TGTGCACTCT TATCCCACTC TTTTTGTGTG TTTTGTTATG CTAAATTGCA GGTTGATGAG ATGATGGGGA AATCAGCATC
TGCCATGGTG CTGTACTCGA AGGCAGTATC CATGCTGCGC TTTCTCCTGA CTGAGGCACC GTCACTCGCC CTGAACCCCG
CTCTGTCCCT AACAAGAGAT GATCGACGCC GCCTGCGCAC ATACATTGAA GCCGTTAACG CTAGGCTCGT CCCGTTGCAA
TACCAGCGGC ACTGACCGCT CACCTGTACA ATATTCTTTC ATCCTGTACA TATATTCGTT GGCCCAAACG AGGGCGTGTA
AGATATGTCA TGTCTGAGAA CGTGCTCCGA TTAGGGAGAA GTAGCGAAAA ATCCAGTGTA ACTTGCCCAA ACTGCCTACT
GTAACGTGAG CTCGGTGTGC TTGCATGGTA CGCCTGATTA TCAGGCAGCT CAGGTTGGCA GCTGAAGGCC CGACCATGGT
CGTTTGTGGA CATGTAAAGC AGACTGCTAC CTCGATGGTT TGTTCATTAA AATTTGGGCT TTTACACTGC 

Locus: Os03g0268200

Loading...

Locus: Os03g0268200

Loading...