Os03t0277600-01

Locus

Os03g0277600

Description

Similar to (clone wusl1032) mRNA sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDUF26, CRRSP, OsCRRSP55, CRRSP55

Oryzabase Gene Name Synonym(s)

domain unknown function 26, Cys Rich Repeat Secretory Protein 55, cysteine-rich repeat secretory protein 55

Transcript Evidence

AK061425 (DDBJ, Best hit)

Protein Evidence

B6SUE5 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Gnk2-homologous domain (IPR002902)

Full-length cDNA

006-306-G05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0277600-01)

RiceXPro (AK061425)

Others

Oryzabase (10232)

KEGG (Os03t0277600-01)

Transcript

1133 bp

>Os03t0277600-01 Similar to (clone wusl1032) mRNA sequence.
GAACCCAAGCCCCCCACACACACTTCTAACTAGCTAGGTGTGATACACAGCAGTGACAGT
GAGAGTGAGAGTGAGCTTGAGTGATCATAGCCATGGCATTCAGTAGCAAAGCTTGCCGTT
GCTTGGTGCTCATGTCATTTGCCTTGCTCCCACTGAGCATGGCCATGGACTCCATTGGCA
GCTACTGTTCAGGGAACAGCTTGGCCGGCAACAGCAAGGCCGTGGCAAGCATCAACTCCG
TCCTCACCGACCTCGTCGCCAAGGGCTCCACCGGCGGCGGCTTCGCCACGTCCTCCGCCG
GGAAAGCCAACAACGTCATCTACGGTCTCGCGCAATGCCGCGGCGAcgtctccaccagcg
actgccaggcctgcctcgcctccgccgccaaccagatcctcaccagctgcAACTACCAAT
CCGACTCAAGAATATGGTATGACTACTGCTTCATGCGGTTCGAGAACGAGAACTTCATCG
GGCAGACGGACACAGATGCCGGGGTGATTCTTGTGAACGTGCAGGCGATGGATAACGGCA
AGGCGTTCCAGAAGGCGGTAGGGAAGGTTATGGGCAAGGCAACGTCGCAGGCATCACAGG
CTGGGAGTGGTGGGCTGGGTAGGACGAAGGATCAGTACACGCCGTTCATCAACATCTACG
GGCTGGCACAGTGCACACAGGACTTGTCACCGCTGGCTTGCGCACAGTGTCTGTCAACGG
CGGTGTCAAGGTTCGGTCAATACTGCGGCGCACAACAGGGATGTCAGATTAACTACAGTA
GCTGCAGGGTGCGCTACGAGATCTATCCCTTCTACTTCCCGCTCGCCACCAGCGCACGCA
GCGCCACCACTGACATGACCAAGTACACCAAGATCGTTGTGCACCGCTAAGCATCCATGG
TTAGTTGCACGTACATGGTGATGTGCGCATGCAAAAGTTGCAAACACATCACGTACGTAC
GTATTAATGTTCAACGTATTATGTGTCTGTGGATGTTTCAGCGTGCAGTGGATGAATAAT
CAAGGCTATAAAATGTAGCCTTAGCATGTTATAACTGGGAATAAAGATGTGAGTACTAGC
TAAGCAATGTACGCGCACATTCGTGTGGAGTAATAATATTAGAGTTTTTAACC

CDS

798 bp

>Os03t0277600-01 Similar to (clone wusl1032) mRNA sequence.
ATGGCATTCAGTAGCAAAGCTTGCCGTTGCTTGGTGCTCATGTCATTTGCCTTGCTCCCA
CTGAGCATGGCCATGGACTCCATTGGCAGCTACTGTTCAGGGAACAGCTTGGCCGGCAAC
AGCAAGGCCGTGGCAAGCATCAACTCCGTCCTCACCGACCTCGTCGCCAAGGGCTCCACC
GGCGGCGGCTTCGCCACGTCCTCCGCCGGGAAAGCCAACAACGTCATCTACGGTCTCGCG
CAATGCCGCGGCGAcgtctccaccagcgactgccaggcctgcctcgcctccgccgccaac
cagatcctcaccagctgcAACTACCAATCCGACTCAAGAATATGGTATGACTACTGCTTC
ATGCGGTTCGAGAACGAGAACTTCATCGGGCAGACGGACACAGATGCCGGGGTGATTCTT
GTGAACGTGCAGGCGATGGATAACGGCAAGGCGTTCCAGAAGGCGGTAGGGAAGGTTATG
GGCAAGGCAACGTCGCAGGCATCACAGGCTGGGAGTGGTGGGCTGGGTAGGACGAAGGAT
CAGTACACGCCGTTCATCAACATCTACGGGCTGGCACAGTGCACACAGGACTTGTCACCG
CTGGCTTGCGCACAGTGTCTGTCAACGGCGGTGTCAAGGTTCGGTCAATACTGCGGCGCA
CAACAGGGATGTCAGATTAACTACAGTAGCTGCAGGGTGCGCTACGAGATCTATCCCTTC
TACTTCCCGCTCGCCACCAGCGCACGCAGCGCCACCACTGACATGACCAAGTACACCAAG
ATCGTTGTGCACCGCTAA

Protein

266 aa

>Os03t0277600-01 Similar to (clone wusl1032) mRNA sequence.
MAFSSKACRCLVLMSFALLPLSMAMDSIGSYCSGNSLAGNSKAVASINSVLTDLVAKGST
GGGFATSSAGKANNVIYGLAQCRGDVSTSDCQACLASAANQILTSCNYQSDSRIWYDYCF
MRFENENFIGQTDTDAGVILVNVQAMDNGKAFQKAVGKVMGKATSQASQAGSGGLGRTKD
QYTPFINIYGLAQCTQDLSPLACAQCLSTAVSRFGQYCGAQQGCQINYSSCRVRYEIYPF
YFPLATSARSATTDMTKYTKIVVHR*

5'UTR

chr03:9422834..9422925 (- strand) : 92 bp

CDS

chr03:9422490..9422833 (- strand) : 344 bp

chr03:9421942..9422395 (- strand) : 454 bp

3'UTR

chr03:9421699..9421941 (- strand) : 243 bp

FASTA

>Os03t0277600-01 class=Sequence position=chr03:9421699..9422925 (- strand)
GAACCCAAGC CCCCCACACA CACTTCTAAC TAGCTAGGTG TGATACACAG CAGTGACAGT GAGAGTGAGA GTGAGCTTGA
GTGATCATAG CCATGGCATT CAGTAGCAAA GCTTGCCGTT GCTTGGTGCT CATGTCATTT GCCTTGCTCC CACTGAGCAT
GGCCATGGAC TCCATTGGCA GCTACTGTTC AGGGAACAGC TTGGCCGGCA ACAGCAAGGC CGTGGCAAGC ATCAACTCCG
TCCTCACCGA CCTCGTCGCC AAGGGCTCCA CCGGCGGCGG CTTCGCCACG TCCTCCGCCG GGAAAGCCAA CAACGTCATC
TACGGTCTCG CGCAATGCCG CGGCGAcgtc tccaccagcg actgccaggc ctgcctcgcc tccgccgcca accagatcct
caccagctgc AACTACCAAT CCGACTCAAG AATATGGTAT ATATGCCAAG TGTGATGACC ACAAACATAC GAAAAAACAA
TGAATTCAGG CGACTGATAA ACTTCAAAAC TATAATTATT CTACGTGCAG GTATGACTAC TGCTTCATGC GGTTCGAGAA
CGAGAACTTC ATCGGGCAGA CGGACACAGA TGCCGGGGTG ATTCTTGTGA ACGTGCAGGC GATGGATAAC GGCAAGGCGT
TCCAGAAGGC GGTAGGGAAG GTTATGGGCA AGGCAACGTC GCAGGCATCA CAGGCTGGGA GTGGTGGGCT GGGTAGGACG
AAGGATCAGT ACACGCCGTT CATCAACATC TACGGGCTGG CACAGTGCAC ACAGGACTTG TCACCGCTGG CTTGCGCACA
GTGTCTGTCA ACGGCGGTGT CAAGGTTCGG TCAATACTGC GGCGCACAAC AGGGATGTCA GATTAACTAC AGTAGCTGCA
GGGTGCGCTA CGAGATCTAT CCCTTCTACT TCCCGCTCGC CACCAGCGCA CGCAGCGCCA CCACTGACAT GACCAAGTAC
ACCAAGATCG TTGTGCACCG CTAAGCATCC ATGGTTAGTT GCACGTACAT GGTGATGTGC GCATGCAAAA GTTGCAAACA
CATCACGTAC GTACGTATTA ATGTTCAACG TATTATGTGT CTGTGGATGT TTCAGCGTGC AGTGGATGAA TAATCAAGGC
TATAAAATGT AGCCTTAGCA TGTTATAACT GGGAATAAAG ATGTGAGTAC TAGCTAAGCA ATGTACGCGC ACATTCGTGT
GGAGTAATAA TATTAGAGTT TTTAACC