Os03t0283100-01

Locus

Os03g0283100

Description

Lambda class glutathione S-transferase, Maize In2-1 homologue, Detoxification of some chemical compounds

RAP-DB Gene Symbol Synonym(s)

OsGSTL2

RAP-DB Gene Name Synonym(s)

lambda class glutathione S-transferase 2

CGSNL Gene Symbol

GSTL2

CGSNL Gene Name

LAMBDA GLUTATHIONE S-TRANSFERASE 2

Oryzabase Gene Symbol Synonym(s)

OsGSTL2

Oryzabase Gene Name Synonym(s)

lambda class glutathione S-transferase 2

Transcript Evidence

AK065887

Protein Evidence

Q8H8U5

Literature

PMID: 21899054

Note

Manual Curation

September 1, 2020

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Thioredoxin-like superfamily (IPR036249)

Glutathione S-transferase, C-terminal domain superfamily (IPR036282)

Glutathione Transferase family (IPR040079)

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal-like (IPR010987)

Full-length cDNA

J013044J05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0283100-01)

RiceXPro (AK065887)

Others

Oryzabase (9460)

KEGG (Os03t0283100-01)

Transcript

1250 bp

>Os03t0283100-01 Lambda class glutathione S-transferase, Maize In2-1 homologue, Detoxification of some chemical compounds
GCTCGCTTTCCCTCGCGGCCGATGCTCCCCGTCACCACTGACGCGCCCCTCCACCTCCCG
TAGTTCTTCCGTCCCATCGTCGCGCACAATAAAGATTCGCCCGAGCTCGCGAAGCGTCGC
CCGGTGCAACCTCCGCGACGCCAAGAATCTCTCCCCGTCCCGCACCGTCGCCATGGCTGC
CGCGGCCGCCGCACCGGCAAGCTCTGAGAAGGAAGTGCTCCCCCCTTCCCTGACCTCCTC
ATCGGAGCCCCCTCCCCTCTTCGATGGAACCACCAGGTTGTACGTTGCGTACCACTGCCC
TTACGCGCAGCGCGCGTGGATTGCCAGGAACTACAAGGGTTTGCAGGATAAGATCAAGAT
TGTCGCGATTGATCTTGCAGACAGGCCTGCTTGGTACAAGGAGAAGGTTTACCCAGAGAA
CAAGGTACCTTCACTTGAGCACAACAATCAGGTGAAAGGAGAAAGCTTGGATTTGGTCAA
GTACATTGACACCAATTTCGAAGGGCCAGCATTACTCCCTGATGATTCTGAGAAGCAGCA
GTTCGCTGAGGAGCTTCTTGCGTACACTGATGCGTTCAACAAAGCATCGTACTCATCCAT
AGTCGCCAAGGGAGATGTGTGCGATGAGGCTGTTGCTGCTCTTGACAAAATAGAAGCTGC
TCTGTCAAAGTTCAACGATGGCCCATTCTTCCTTGGCCAGTTCAGCTTGGTGGACATTGC
GTATGTTCCATTTATTGAAAGGTTTCAGATATTCTTTTCTGGTATAAAGAACTACGATAT
CACCAAGGGCCGACCCAACCTTCAGAAATTCATCGAGGAAGTGAACAAGATTCATGCCTA
TACAGAAACCAAACAGGACCCACAGTTTTTGCTTGAACACACAAAGAAGCGTCTTGGGAT
TGCCTGAAGATGTGACCAAGGATGAACCCACAACAACCTGCGATGGAGACAGGGAGCTGG
TGCAGTATATAGTAGATAAAGACTAGTGTGCTTCATTTTAGCATATGGTTTATCTTGAAT
AAGATAATGCATGTCATGCAGACCATGCTTATGGAACAAACTATTATGTATTTTTGGTTT
GGCTGTGTACAGCTGTTAATGTGAATTTCCCGTCATATAATTAATTACAAGCTTCGCGGG
GCGTTGTCTAATAAATCAATGCTTCTTGTATCATTATTACTAGTTGTCAGGATGATTTTC
ATAGTGAAGTACTTCTGCAAATATGCTAAGCAGAAGTCAACCGGACGTTC

CDS

735 bp

>Os03t0283100-01 Lambda class glutathione S-transferase, Maize In2-1 homologue, Detoxification of some chemical compounds
ATGGCTGCCGCGGCCGCCGCACCGGCAAGCTCTGAGAAGGAAGTGCTCCCCCCTTCCCTG
ACCTCCTCATCGGAGCCCCCTCCCCTCTTCGATGGAACCACCAGGTTGTACGTTGCGTAC
CACTGCCCTTACGCGCAGCGCGCGTGGATTGCCAGGAACTACAAGGGTTTGCAGGATAAG
ATCAAGATTGTCGCGATTGATCTTGCAGACAGGCCTGCTTGGTACAAGGAGAAGGTTTAC
CCAGAGAACAAGGTACCTTCACTTGAGCACAACAATCAGGTGAAAGGAGAAAGCTTGGAT
TTGGTCAAGTACATTGACACCAATTTCGAAGGGCCAGCATTACTCCCTGATGATTCTGAG
AAGCAGCAGTTCGCTGAGGAGCTTCTTGCGTACACTGATGCGTTCAACAAAGCATCGTAC
TCATCCATAGTCGCCAAGGGAGATGTGTGCGATGAGGCTGTTGCTGCTCTTGACAAAATA
GAAGCTGCTCTGTCAAAGTTCAACGATGGCCCATTCTTCCTTGGCCAGTTCAGCTTGGTG
GACATTGCGTATGTTCCATTTATTGAAAGGTTTCAGATATTCTTTTCTGGTATAAAGAAC
TACGATATCACCAAGGGCCGACCCAACCTTCAGAAATTCATCGAGGAAGTGAACAAGATT
CATGCCTATACAGAAACCAAACAGGACCCACAGTTTTTGCTTGAACACACAAAGAAGCGT
CTTGGGATTGCCTGA

Protein

245 aa

>Os03t0283100-01 Lambda class glutathione S-transferase, Maize In2-1 homologue, Detoxification of some chemical compounds
MAAAAAAPASSEKEVLPPSLTSSSEPPPLFDGTTRLYVAYHCPYAQRAWIARNYKGLQDK
IKIVAIDLADRPAWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDTNFEGPALLPDDSE
KQQFAEELLAYTDAFNKASYSSIVAKGDVCDEAVAALDKIEAALSKFNDGPFFLGQFSLV
DIAYVPFIERFQIFFSGIKNYDITKGRPNLQKFIEEVNKIHAYTETKQDPQFLLEHTKKR
LGIA*

5'UTR

chr03:9714749..9714920 (- strand) : 172 bp

CDS

chr03:9714720..9714748 (- strand) : 29 bp

chr03:9714540..9714614 (- strand) : 75 bp

chr03:9714348..9714408 (- strand) : 61 bp

chr03:9714102..9714188 (- strand) : 87 bp

chr03:9713590..9713688 (- strand) : 99 bp

chr03:9713389..9713497 (- strand) : 109 bp

chr03:9713201..9713277 (- strand) : 77 bp

chr03:9712979..9713086 (- strand) : 108 bp

chr03:9712699..9712779 (- strand) : 81 bp

chr03:9712567..9712575 (- strand) : 9 bp

3'UTR

chr03:9712224..9712566 (- strand) : 343 bp

FASTA

>Os03t0283100-01 class=Sequence position=chr03:9712224..9714920 (- strand)
GCTCGCTTTC CCTCGCGGCC GATGCTCCCC GTCACCACTG ACGCGCCCCT CCACCTCCCG TAGTTCTTCC GTCCCATCGT
CGCGCACAAT AAAGATTCGC CCGAGCTCGC GAAGCGTCGC CCGGTGCAAC CTCCGCGACG CCAAGAATCT CTCCCCGTCC
CGCACCGTCG CCATGGCTGC CGCGGCCGCC GCACCGGCAA GGTGAGCACG CGTGCCGGCT GCGGCGAGGC TGAGGAGAAG
AATAAACCGC TTGTTGCGGT TCTTGATTAA AATCTGAATT TCTTTGCTTC TCTTACTCAT GTGCAGCTCT GAGAAGGAAG
TGCTCCCCCC TTCCCTGACC TCCTCATCGG AGCCCCCTCC CCTCTTCGAT GGAACCACCA GGTAGGGTTT ATGCAGACAA
AAAAAAAAGT TTAAAAAAGA AAAAAAACGA AAGGAATTGC AGTTATCTGA ACTTTTCTGG TTTCTGCAAT CTGCATAGAT
TAGGGGTAAT TTGATTTGTT TGCCTTGCGC AGGTTGTACG TTGCGTACCA CTGCCCTTAC GCGCAGCGCG CGTGGATTGC
CAGGAACTAC AAGGTATTAC ATGCTGTTCT TTGATTTGCG GACTCGGTTC GTAGTTTTGG GAGATTGGAT CACATACCCT
CCATTTAGAT CGGGAATTGA AGACTTCTCT AGTTTTGTGG TGGTGTTTCT CCGATAAAAT TGGATCTTTT TTGTTTGTCT
TTTCGTTTCC AGGGTTTGCA GGATAAGATC AAGATTGTCG CGATTGATCT TGCAGACAGG CCTGCTTGGT ACAAGGAGAA
GGTTTACCCA GAGAACAAGG TATAGAGTAT CCCTGGtgtt gagttgtgat ccaaatttat ttgcacttaa taaaagcgag
cttcagccga cggatcgtca tctttttagg gttccaccat atatatacct cttgtaagcc gccgtgcggc gatgtaatct
caccccagat ataatgaaga tattttgctg gctagcgccc gtggtttttt ctgtccggtt ttggaagggt tttccacgtt
aaatctcgtg tcttatatga ttgatctatt attatttatc gtttgttcgc ctatcgtttc ctaacaCCTT GTTACTGTCA
AGTCTCAACT CTGCTCCAAT AAAAAAGAAA AATCCTTTAC AGCTTAATTT GCTATAGGTG TGCACTTACT TTTTTTTGCC
GGGTCTGTGT ATGCACTTTT ACTTTTTGAT AGGTACCTTC ACTTGAGCAC AACAATCAGG TGAAAGGAGA AAGCTTGGAT
TTGGTCAAGT ACATTGACAC CAATTTCGAA GGGCCAGCAT TACTCCCTGA TGTAAGACGA TATGTTCAAC TTTCACTGGT
GTAATGCTTG CAAAAAGAGA AGTAATTTAT AATGTGTTAG CCTTTGAATG TGTAATTTGA CAGGATTCTG AGAAGCAGCA
GTTCGCTGAG GAGCTTCTTG CGTACACTGA TGCGTTCAAC AAAGCATCGT ACTCATCCAT AGTCGCCAAG GGAGATGTGT
GCGATGAGGC TGGTGAGAGC ACTCGTGTAC TACTACTTGA TTACTCATTT GAACGATTTT TTATGCATAA ATTCTGCAGT
TTGTATCCAC GTGCTAATCT GCTAATATAA TACTCTTCGT CAGTTGCTGC TCTTGACAAA ATAGAAGCTG CTCTGTCAAA
GTTCAACGAT GGCCCATTCT TCCTTGGCCA GTTCAGCTTG GTACGCCACT ATAGTCTGGG AATGTTTTTC CCTGGATTAT
CATTTAAAAT TATTTTTGAA AGCTTTTTGT TTTTGCTGAA AAAAATGTGC TTGATACTCC TTATTTCTTT CCAGGTGGAC
ATTGCGTATG TTCCATTTAT TGAAAGGTTT CAGATATTCT TTTCTGGTAT AAAGAACTAC GATATCACCA AGGGCCGACC
CAACCTTCAG AAATTCATCG AGGTAATTCA GAATGATGGT ACATGAGAAT GTGAGATTGC GCCATATGTT AGTTGGTTGG
GATTATGTTT ACCCTATTTT TATTGACGTT GTTTCGAATA CTAGTTCCTG TGGCCAAAGA TCACATGGTG TAGTTCAAAT
CAATGTTCTT GTTAGAAAAA ACTTCGCTGA GGAGAAACTA ACTCAAATTG ATATGTTACA GGAAGTGAAC AAGATTCATG
CCTATACAGA AACCAAACAG GACCCACAGT TTTTGCTTGA ACACACAAAG AAGCGTCTTG GGGTAAGATA TATTTACAAT
TGTTCTTATG ATCTCCTTCC GCCGACCCGG CAAAATTGTT CTTATGATCC ATTTCATCTG CCGACATACT ACATTTATAC
ATTTTTTGCA CATTTTAACT TCCAGATTGC CTGAAGATGT GACCAAGGAT GAACCCACAA CAACCTGCGA TGGAGACAGG
GAGCTGGTGC AGTATATAGT AGATAAAGAC TAGTGTGCTT CATTTTAGCA TATGGTTTAT CTTGAATAAG ATAATGCATG
TCATGCAGAC CATGCTTATG GAACAAACTA TTATGTATTT TTGGTTTGGC TGTGTACAGC TGTTAATGTG AATTTCCCGT
CATATAATTA ATTACAAGCT TCGCGGGGCG TTGTCTAATA AATCAATGCT TCTTGTATCA TTATTACTAG TTGTCAGGAT
GATTTTCATA GTGAAGTACT TCTGCAAATA TGCTAAGCAG AAGTCAACCG GACGTTC

Locus: Os03g0283100

Loading...

Locus: Os03g0283100

Loading...