Os03t0283100-02

Locus

Os03g0283100

Description

Similar to In2-1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GSTL2

CGSNL Gene Name

LAMBDA GLUTATHIONE S-TRANSFERASE 2

Oryzabase Gene Symbol Synonym(s)

OsGSTL2

Oryzabase Gene Name Synonym(s)

lambda class glutathione S-transferase 2

Transcript Evidence

AK061849 (DDBJ, Best hit)

Protein Evidence

Q8H8U5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal (IPR004046)

Glutathione S-transferase, C-terminal-like (IPR010987)

Thioredoxin-like fold (IPR012336)

Glutathione S-transferase/chloride channel, C-terminal (IPR017933)

Full-length cDNA

001-040-F06 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0283100-02)

RiceXPro (AK061849)

Others

Oryzabase (9460)

KEGG (Os03t0283100-02)

Transcript

1029 bp

>Os03t0283100-02 Similar to In2-1 protein.
GTGCAACCTCCGCGACGCCAAGAATCTCTCCCCGTCCCGCACCGTCGCCATGGCTGCCGC
GGCCGCCGCACCGGCAAGCTCTGAGAAGGAAGTGCTCCCCCCTTCCCTGACCTCCTCATC
GGAGCCCCCTCCCCTCTTCGATGGAACCACCAGGTTGTACGTTGCGTACCACTGCCCTTA
CGCGCAGCGCGCGTGGATTGCCAGGAACTACAAGGGTTTGCAGGATAAGATCAAGATTGT
CGCGATTGATCTTGCAGACAGGCCTGCTTGGTACAAGGAGAAGGTTTACCCAGAGAACAA
GGTACCTTCACTTGAGCACAACAATCAGGTGAAAGGAGAAAGCTTGGATTTGGTCAAGTA
CATTGACACCAATTTCGAAGGGCCAGCATTACTCCCTGATGATTCTGAGAAGCAGCAGTT
CGCTGAGGAGCTTCTTGCGTACACTGATGCGTTCAACAAAGCATCGTACTCATCCATAGT
CGCCAAGGGAGATGTGTGCGATGAGGCTGTTGCTGCTCTTGACAAAATAGAAGCTGCTCT
GTCAAAGTTCAACGATGGCCCATTCTTCCTTGGCCAGTTCAGCTTGGTGGACATTGCGTA
TGTTCCATTTATTGAAAGGTTTCAGATATTCTTTTCTGGTATAAAGAACTACGATATCAC
CAAGGGCCGACCCAACCTTCAGAAATTCATCGAGGAAGTGAACAAGATTCATGCCTATAC
AGAAACCAAACAGGACCCACAGTTTTTGCTTGAACACACAAAGAAGCGTCTTGGGATTGC
CTGAAGATGTGACCAAGGATGAACCCACAACAACCTGCGATGGAGACAGGGAGCTGGTGC
AGTATATAGTAGATAAAGACTAGTGTGCTTCATTTTAGCATATGGTTTATCTTGAATAAG
ATAATGCATGTCATGCAGACCATGCTTATGGAACAAACTATTATGTATTTTTGGTTTGGC
TGTGTACAGCTGTTAATGTGAATTTCCCGTCATATAATTAATTACAAGCTTCGCGGGGCG
TTGTCTAAT

CDS

735 bp

>Os03t0283100-02 Similar to In2-1 protein.
ATGGCTGCCGCGGCCGCCGCACCGGCAAGCTCTGAGAAGGAAGTGCTCCCCCCTTCCCTG
ACCTCCTCATCGGAGCCCCCTCCCCTCTTCGATGGAACCACCAGGTTGTACGTTGCGTAC
CACTGCCCTTACGCGCAGCGCGCGTGGATTGCCAGGAACTACAAGGGTTTGCAGGATAAG
ATCAAGATTGTCGCGATTGATCTTGCAGACAGGCCTGCTTGGTACAAGGAGAAGGTTTAC
CCAGAGAACAAGGTACCTTCACTTGAGCACAACAATCAGGTGAAAGGAGAAAGCTTGGAT
TTGGTCAAGTACATTGACACCAATTTCGAAGGGCCAGCATTACTCCCTGATGATTCTGAG
AAGCAGCAGTTCGCTGAGGAGCTTCTTGCGTACACTGATGCGTTCAACAAAGCATCGTAC
TCATCCATAGTCGCCAAGGGAGATGTGTGCGATGAGGCTGTTGCTGCTCTTGACAAAATA
GAAGCTGCTCTGTCAAAGTTCAACGATGGCCCATTCTTCCTTGGCCAGTTCAGCTTGGTG
GACATTGCGTATGTTCCATTTATTGAAAGGTTTCAGATATTCTTTTCTGGTATAAAGAAC
TACGATATCACCAAGGGCCGACCCAACCTTCAGAAATTCATCGAGGAAGTGAACAAGATT
CATGCCTATACAGAAACCAAACAGGACCCACAGTTTTTGCTTGAACACACAAAGAAGCGT
CTTGGGATTGCCTGA

Protein

245 aa

>Os03t0283100-02 Similar to In2-1 protein.
MAAAAAAPASSEKEVLPPSLTSSSEPPPLFDGTTRLYVAYHCPYAQRAWIARNYKGLQDK
IKIVAIDLADRPAWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDTNFEGPALLPDDSE
KQQFAEELLAYTDAFNKASYSSIVAKGDVCDEAVAALDKIEAALSKFNDGPFFLGQFSLV
DIAYVPFIERFQIFFSGIKNYDITKGRPNLQKFIEEVNKIHAYTETKQDPQFLLEHTKKR
LGIA*

5'UTR

chr03:9714749..9714797 (- strand) : 49 bp

CDS

chr03:9714720..9714748 (- strand) : 29 bp

chr03:9714540..9714614 (- strand) : 75 bp

chr03:9714348..9714408 (- strand) : 61 bp

chr03:9714102..9714188 (- strand) : 87 bp

chr03:9713590..9713688 (- strand) : 99 bp

chr03:9713389..9713497 (- strand) : 109 bp

chr03:9713201..9713277 (- strand) : 77 bp

chr03:9712979..9713086 (- strand) : 108 bp

chr03:9712699..9712779 (- strand) : 81 bp

chr03:9712567..9712575 (- strand) : 9 bp

3'UTR

chr03:9712322..9712566 (- strand) : 245 bp

FASTA

>Os03t0283100-02 class=Sequence position=chr03:9712322..9714797 (- strand)
GTGCAACCTC CGCGACGCCA AGAATCTCTC CCCGTCCCGC ACCGTCGCCA TGGCTGCCGC GGCCGCCGCA CCGGCAAGGT
GAGCACGCGT GCCGGCTGCG GCGAGGCTGA GGAGAAGAAT AAACCGCTTG TTGCGGTTCT TGATTAAAAT CTGAATTTCT
TTGCTTCTCT TACTCATGTG CAGCTCTGAG AAGGAAGTGC TCCCCCCTTC CCTGACCTCC TCATCGGAGC CCCCTCCCCT
CTTCGATGGA ACCACCAGGT AGGGTTTATG CAGACAAAAA AAAAAGTTTA AAAAAGAAAA AAAACGAAAG GAATTGCAGT
TATCTGAACT TTTCTGGTTT CTGCAATCTG CATAGATTAG GGGTAATTTG ATTTGTTTGC CTTGCGCAGG TTGTACGTTG
CGTACCACTG CCCTTACGCG CAGCGCGCGT GGATTGCCAG GAACTACAAG GTATTACATG CTGTTCTTTG ATTTGCGGAC
TCGGTTCGTA GTTTTGGGAG ATTGGATCAC ATACCCTCCA TTTAGATCGG GAATTGAAGA CTTCTCTAGT TTTGTGGTGG
TGTTTCTCCG ATAAAATTGG ATCTTTTTTG TTTGTCTTTT CGTTTCCAGG GTTTGCAGGA TAAGATCAAG ATTGTCGCGA
TTGATCTTGC AGACAGGCCT GCTTGGTACA AGGAGAAGGT TTACCCAGAG AACAAGGTAT AGAGTATCCC TGGtgttgag
ttgtgatcca aatttatttg cacttaataa aagcgagctt cagccgacgg atcgtcatct ttttagggtt ccaccatata
tatacctctt gtaagccgcc gtgcggcgat gtaatctcac cccagatata atgaagatat tttgctggct agcgcccgtg
gttttttctg tccggttttg gaagggtttt ccacgttaaa tctcgtgtct tatatgattg atctattatt atttatcgtt
tgttcgccta tcgtttccta acaCCTTGTT ACTGTCAAGT CTCAACTCTG CTCCAATAAA AAAGAAAAAT CCTTTACAGC
TTAATTTGCT ATAGGTGTGC ACTTACTTTT TTTTGCCGGG TCTGTGTATG CACTTTTACT TTTTGATAGG TACCTTCACT
TGAGCACAAC AATCAGGTGA AAGGAGAAAG CTTGGATTTG GTCAAGTACA TTGACACCAA TTTCGAAGGG CCAGCATTAC
TCCCTGATGT AAGACGATAT GTTCAACTTT CACTGGTGTA ATGCTTGCAA AAAGAGAAGT AATTTATAAT GTGTTAGCCT
TTGAATGTGT AATTTGACAG GATTCTGAGA AGCAGCAGTT CGCTGAGGAG CTTCTTGCGT ACACTGATGC GTTCAACAAA
GCATCGTACT CATCCATAGT CGCCAAGGGA GATGTGTGCG ATGAGGCTGG TGAGAGCACT CGTGTACTAC TACTTGATTA
CTCATTTGAA CGATTTTTTA TGCATAAATT CTGCAGTTTG TATCCACGTG CTAATCTGCT AATATAATAC TCTTCGTCAG
TTGCTGCTCT TGACAAAATA GAAGCTGCTC TGTCAAAGTT CAACGATGGC CCATTCTTCC TTGGCCAGTT CAGCTTGGTA
CGCCACTATA GTCTGGGAAT GTTTTTCCCT GGATTATCAT TTAAAATTAT TTTTGAAAGC TTTTTGTTTT TGCTGAAAAA
AATGTGCTTG ATACTCCTTA TTTCTTTCCA GGTGGACATT GCGTATGTTC CATTTATTGA AAGGTTTCAG ATATTCTTTT
CTGGTATAAA GAACTACGAT ATCACCAAGG GCCGACCCAA CCTTCAGAAA TTCATCGAGG TAATTCAGAA TGATGGTACA
TGAGAATGTG AGATTGCGCC ATATGTTAGT TGGTTGGGAT TATGTTTACC CTATTTTTAT TGACGTTGTT TCGAATACTA
GTTCCTGTGG CCAAAGATCA CATGGTGTAG TTCAAATCAA TGTTCTTGTT AGAAAAAACT TCGCTGAGGA GAAACTAACT
CAAATTGATA TGTTACAGGA AGTGAACAAG ATTCATGCCT ATACAGAAAC CAAACAGGAC CCACAGTTTT TGCTTGAACA
CACAAAGAAG CGTCTTGGGG TAAGATATAT TTACAATTGT TCTTATGATC TCCTTCCGCC GACCCGGCAA AATTGTTCTT
ATGATCCATT TCATCTGCCG ACATACTACA TTTATACATT TTTTGCACAT TTTAACTTCC AGATTGCCTG AAGATGTGAC
CAAGGATGAA CCCACAACAA CCTGCGATGG AGACAGGGAG CTGGTGCAGT ATATAGTAGA TAAAGACTAG TGTGCTTCAT
TTTAGCATAT GGTTTATCTT GAATAAGATA ATGCATGTCA TGCAGACCAT GCTTATGGAA CAAACTATTA TGTATTTTTG
GTTTGGCTGT GTACAGCTGT TAATGTGAAT TTCCCGTCAT ATAATTAATT ACAAGCTTCG CGGGGCGTTG TCTAAT

Locus: Os03g0283100

Loading...

Locus: Os03g0283100

Loading...