Os03t0285800-01

Locus

Os03g0285800

Description

MAP Kinase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MSRMK2

CGSNL Gene Name

MULTIPLE STRESS RESPONSIVE MAP KINASE 2

Oryzabase Gene Symbol Synonym(s)

OsMSRMK2, OsMAPK5, OsMAP1, OsMPK3, OsBIMK1, OsMAPK2, MPK5, BIMK1, MAPK2, MAPK5, MPK3, OsMPK5, OsMAPK3, OsMAPK5b, MAPK3

Oryzabase Gene Name Synonym(s)

multiple stress responsive MAP kinase 2, Mitogen-activated protein kinase 5, MAP kinase 5, Benzothiadiazole-induced MAP kinase 1, BTH-induced MAPK 1, MAP kinase 2, Multiple stress-responsive MAP kinase 2, MAP kinase 3

Transcript Evidence

AK067339 (DDBJ, Best hit)

Protein Evidence

Q10N20 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

MAP kinase, conserved site (IPR003527)

Serine/threonine-protein kinase, active site (IPR008271)

JNK MAP kinase (IPR008351)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J013102O17 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0285800-01)

Others

Oryzabase (6224)

Transcript

1489 bp

>Os03t0285800-01 MAP Kinase.
AGCGATCACAAATTGTGCCAATTCACAAACCGCCGCCCCCTTCCCTTTTTAATAGCTGCC
TTCGCCTCTCGTCCCCTCTCCCTCATCGCCTTGCTGTCTCTGCGAATCGAGAGAGAGTCA
GATAAGGTCGTTAATTAGGTTTGTCAATTCGGCTGCTTGCGGCGAGAGAAGAGGAGGAGG
GATTAGGGATGGACGGGGCGCCGGTGGCGGAGTTCAGGCCGACGATGACGCACGGCGGCC
GGTACCTGCTCTACGACATCTTCGGGAACAAGTTCGAGGTGACGAACAAGTACCAGCCGC
CCATCATGCCCATTGGCCGCGGCGCCTACGGGATCGTCTGCTCCGTGATGAACTTTGAGA
CGAGGGAGATGGTGGCGATAAAGAAGATCGCCAACGCGTTCAACAACGACATGGACGCCA
AGCGCACGCTCCGGGAGATCAAGCTCCTCAGGCACCTCGACCACGAGAACATCATAGGCA
TCAGGGATGTGATCCCGCCGCCGATCCCTCAGGCGTTCAACGACGTCTACATCGCCACGG
AGCTCATGGACACCGACCTCCATCACATCATCCGCTCCAACCAAGAACTGTCAGAAGAGC
ACTGCCAGTATTTCCTGTACCAGATCCTGCGGgggctcaagtacatccactcggcgaacg
tgatccaccgcgacctgaagccgagcaacctgctgctgaacgccaactgcgacctcaaga
tctgcgacttcgggctggcgcggccgtcgtcggagagcgacatgatgacggagtacgtgg
tcacccggtggtaccgcgcgccggagctgctGCTCAACTCCACCGACTACTCCGCCGCCA
TCGACGTCTGGTCCGTCGGCTGCATCTTCATGGAGCTCATCAACCGCCAGCCGCTCTTCC
CCGGCAGGGACCACATGCACCAGATGCGCCTCATCACCGAGGTGATCGGGACGCCGACGG
ACGACGAGCTGGGGTTCATACGGAACGAGGACGCGAGGAAGTACATGAGGCACCTGCCGC
AGTACCCGCGCCGGACGTTCGCGAGCATGTTCCCGCGGGTGCAGCCCGCCGCGCTCGACC
TCATCGAGAGGATGCTCACCTTCAACCCGCTGCAGAGAATCACAGTTGAGGAGGCGCTCG
ATCATCCTTACCTAGAGAGATTGCACGACATCGCCGATGAGCCCATCTGCCTGGAGCCCT
TCTCCTTCGACTTCGAGCAGAAGGCTCTAAACGAGGACCAAATGAAGCAGCTGATCTTCA
ACGAAGCGATCGAGATGAACCCAAACATCCGGTACTAGATTGAATCACCATGGAAATGAG
ATCCCGTCTATACCTGCTTTGTACATATGATCAAGATTGAGAGCCGGGTAGACTGAACAT
TGCATTTGTTTGTTTGTTGATGTTCGAAACCCACATTCTCTGCAAGTTGTGGCTGCTTTG
TATGATATATGGTACTATGTTCGAATAAAAGGGTTTGGAACTTTGGATT

CDS

1110 bp

>Os03t0285800-01 MAP Kinase.
ATGGACGGGGCGCCGGTGGCGGAGTTCAGGCCGACGATGACGCACGGCGGCCGGTACCTG
CTCTACGACATCTTCGGGAACAAGTTCGAGGTGACGAACAAGTACCAGCCGCCCATCATG
CCCATTGGCCGCGGCGCCTACGGGATCGTCTGCTCCGTGATGAACTTTGAGACGAGGGAG
ATGGTGGCGATAAAGAAGATCGCCAACGCGTTCAACAACGACATGGACGCCAAGCGCACG
CTCCGGGAGATCAAGCTCCTCAGGCACCTCGACCACGAGAACATCATAGGCATCAGGGAT
GTGATCCCGCCGCCGATCCCTCAGGCGTTCAACGACGTCTACATCGCCACGGAGCTCATG
GACACCGACCTCCATCACATCATCCGCTCCAACCAAGAACTGTCAGAAGAGCACTGCCAG
TATTTCCTGTACCAGATCCTGCGGgggctcaagtacatccactcggcgaacgtgatccac
cgcgacctgaagccgagcaacctgctgctgaacgccaactgcgacctcaagatctgcgac
ttcgggctggcgcggccgtcgtcggagagcgacatgatgacggagtacgtggtcacccgg
tggtaccgcgcgccggagctgctGCTCAACTCCACCGACTACTCCGCCGCCATCGACGTC
TGGTCCGTCGGCTGCATCTTCATGGAGCTCATCAACCGCCAGCCGCTCTTCCCCGGCAGG
GACCACATGCACCAGATGCGCCTCATCACCGAGGTGATCGGGACGCCGACGGACGACGAG
CTGGGGTTCATACGGAACGAGGACGCGAGGAAGTACATGAGGCACCTGCCGCAGTACCCG
CGCCGGACGTTCGCGAGCATGTTCCCGCGGGTGCAGCCCGCCGCGCTCGACCTCATCGAG
AGGATGCTCACCTTCAACCCGCTGCAGAGAATCACAGTTGAGGAGGCGCTCGATCATCCT
TACCTAGAGAGATTGCACGACATCGCCGATGAGCCCATCTGCCTGGAGCCCTTCTCCTTC
GACTTCGAGCAGAAGGCTCTAAACGAGGACCAAATGAAGCAGCTGATCTTCAACGAAGCG
ATCGAGATGAACCCAAACATCCGGTACTAG

Protein

370 aa

>Os03t0285800-01 MAP Kinase.
MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGRGAYGIVCSVMNFETRE
MVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPPIPQAFNDVYIATELM
DTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICD
FGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPLFPGR
DHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAALDLIE
RMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLIFNEA
IEMNPNIRY*

5'UTR

chr03:9850197..9850384 (- strand) : 188 bp

CDS

chr03:9850045..9850196 (- strand) : 152 bp

chr03:9849601..9849730 (- strand) : 130 bp

chr03:9849349..9849486 (- strand) : 138 bp

chr03:9848885..9849217 (- strand) : 333 bp

chr03:9848617..9848800 (- strand) : 184 bp

chr03:9847914..9848086 (- strand) : 173 bp

3'UTR

chr03:9847723..9847913 (- strand) : 191 bp

FASTA

>Os03t0285800-01 class=Sequence position=chr03:9847723..9850384 (- strand)
AGCGATCACA AATTGTGCCA ATTCACAAAC CGCCGCCCCC TTCCCTTTTT AATAGCTGCC TTCGCCTCTC GTCCCCTCTC
CCTCATCGCC TTGCTGTCTC TGCGAATCGA GAGAGAGTCA GATAAGGTCG TTAATTAGGT TTGTCAATTC GGCTGCTTGC
GGCGAGAGAA GAGGAGGAGG GATTAGGGAT GGACGGGGCG CCGGTGGCGG AGTTCAGGCC GACGATGACG CACGGCGGCC
GGTACCTGCT CTACGACATC TTCGGGAACA AGTTCGAGGT GACGAACAAG TACCAGCCGC CCATCATGCC CATTGGCCGC
GGCGCCTACG GGATCGTCTG GTACGCACAC GCCGATTCCT CTTTTCCCTG CCTGCCCTAG ATTTCTTGCC ATGTTAATCG
ATCCTTCGTC AGTTCCTTTT GATTGATTGA TACGCGTCGA TGAGTGGTTG AGAGGATGGA GTAATTGGGA CCAATTACTA
ATCCCCTGTT TTTAGAGCAG GGATGATTAA TTTGATTCTG CAGCTGAGCT GAGCAGGTTT TTAGTTAGTT ATTATCAGCG
TAGTGGTTGA CTGGTTGGCA TGTCTATTCG GAGTACTTTT TGGTGCTTTG TTTTTCTAAT TTCTCTTCTG AATTCCGTGT
GCTGGTGCCT ACAGCTCCGT GATGAACTTT GAGACGAGGG AGATGGTGGC GATAAAGAAG ATCGCCAACG CGTTCAACAA
CGACATGGAC GCCAAGCGCA CGCTCCGGGA GATCAAGCTC CTCAGGCACC TCGACCACGA GAACGTAAGC TCCTATTAGG
CTATAACTAG TAGTGGAACT GAAGACTACG TGGTTAATTA CGCAGCGGCG TGTACCTGAA TTTGGTAATC TGTCACTAAC
TGCTACAACA ACACGCAGAT CATAGGCATC AGGGATGTGA TCCCGCCGCC GATCCCTCAG GCGTTCAACG ACGTCTACAT
CGCCACGGAG CTCATGGACA CCGACCTCCA TCACATCATC CGCTCCAACC AAGAACTGTC AGAAGAGCAC TGCCAGGTGA
GTGAACTGTG AGCGAATGAT TTTTTTTTTC ATATATCGAT CAATCACACA ATCAATCGAT AGCTGCAGAA ACATCAATTC
GATCTTCCTC ATGTCACGTA TGTATGATTG CGGCCGTGTT GTTGCAGTAT TTCCTGTACC AGATCCTGCG Ggggctcaag
tacatccact cggcgaacgt gatccaccgc gacctgaagc cgagcaacct gctgctgaac gccaactgcg acctcaagat
ctgcgacttc gggctggcgc ggccgtcgtc ggagagcgac atgatgacgg agtacgtggt cacccggtgg taccgcgcgc
cggagctgct GCTCAACTCC ACCGACTACT CCGCCGCCAT CGACGTCTGG TCCGTCGGCT GCATCTTCAT GGAGCTCATC
AACCGCCAGC CGCTCTTCCC CGGCAGGGAC CACATGCACC AGATGCGCCT CATCACCGAG GTGAGTGAAT TAATCAGCGT
AGACACTCAC ACGCTGAATT ATGCTACCTG TTCTTGGGTC TCATCGTGTT GGGTCCATGA TCAGGTGATC GGGACGCCGA
CGGACGACGA GCTGGGGTTC ATACGGAACG AGGACGCGAG GAAGTACATG AGGCACCTGC CGCAGTACCC GCGCCGGACG
TTCGCGAGCA TGTTCCCGCG GGTGCAGCCC GCCGCGCTCG ACCTCATCGA GAGGATGCTC ACCTTCAACC CGCTGCAGAG
AATCACAGGT GCGTGCAGAG GGCTAACCCA ACTCGTGCTT GCTGCTCTGC TTCTAAACTA CTAAAATTAG TACCCAAAAT
TACAAGTACT AATTTACTAG CTGAGTGTGT ACTGTGTACA GTACCCTGTT CAGTATGCTA CTGCATGTGT GCTAGTATAG
CACTAGTATT TTCTATCGCA CTGCTTCTTT GACTGGCGTA TATAGCCGCC GGTGTTTGAC CCATCCCCAA CTATTTTTAT
GTTTACTTGC CGTGAACAGT CGGTCTCTTG ATCTCGTCAC TTTAAAGGGA ACCCGTCTTT TAGCTGTCTT TGGGGCTACC
AACGATTTTG CATGTTGCTC AAGTGACGAT AAAAGACTGT GTTACTTTAC TGTGTAGTAG TGCAGAAGTA GAATAGGTAG
CACGTTTGCA GCCTCTGTCG GTTAGAGTTC AGTAGACCTT AGTTTTGAAA CACTAGACAA TAGCAGAGTG GTTTAGAAGG
ATGACAGAAG ATTTGTGCTT AAGAACTATA TCTCACTGAC ATCGTTCTTG ACATGCAGTT GAGGAGGCGC TCGATCATCC
TTACCTAGAG AGATTGCACG ACATCGCCGA TGAGCCCATC TGCCTGGAGC CCTTCTCCTT CGACTTCGAG CAGAAGGCTC
TAAACGAGGA CCAAATGAAG CAGCTGATCT TCAACGAAGC GATCGAGATG AACCCAAACA TCCGGTACTA GATTGAATCA
CCATGGAAAT GAGATCCCGT CTATACCTGC TTTGTACATA TGATCAAGAT TGAGAGCCGG GTAGACTGAA CATTGCATTT
GTTTGTTTGT TGATGTTCGA AACCCACATT CTCTGCAAGT TGTGGCTGCT TTGTATGATA TATGGTACTA TGTTCGAATA
AAAGGGTTTG GAACTTTGGA TT

Locus: Os03g0285800

Loading...

Locus: Os03g0285800

Loading...