Os03t0299900-01

Locus

Os03g0299900

Description

Similar to Plastid aminotransferase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsAGD2

Oryzabase Gene Name Synonym(s)

aberrant growth and death2

Transcript Evidence

AK069075 (DDBJ, Best hit)

Protein Evidence

NP_001149818.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Biological Process: lysine biosynthetic process via diaminopimelate (GO:0009089)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: L,L-diaminopimelate aminotransferase activity (GO:0010285)

Molecular Function: transferase activity, transferring nitrogenous groups (GO:0016769)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

Functional domain (InterPro)

Aminotransferase, class I/classII (IPR004839)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (IPR015422)

Pyridoxal phosphate-dependent transferase, major domain (IPR015424)

Diaminopimelate aminotransferase, DapL, plant/Chlamydia-type (IPR019942)

Full-length cDNA

J023007K10 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0299900-01)

RiceXPro (AK069075)

Others

Oryzabase (13986)

KEGG (Os03t0299900-01 (EC:2.6.1.83))

Transcript

1788 bp

>Os03t0299900-01 Similar to Plastid aminotransferase (Fragment).
AATCCGACCCGCGCCGCCGCCACCTCTTCCTCCGCTGCCCAAGAGCGATGGCCGCCTCCC
CCGCCGCCGGGGCCGCGGCCGCCACCGTCTCGTCGTTCGTCTCGCCGTCGTCCTTCTCCT
CCGTCAAGGCATCGAAGCCCGACCGCCTCCGTCCGGCGAGGAGGGCGGCGGCCGTCAACG
TCCGATGCGTCAGCAGCCCTCCGGCCACCGAAACTTCTTTCAAGACGAAAGTACCACGAA
ATGCCAATATGGCCAAGCTGCAAGCTGGCTATCTGTTTCCTGAGATTGCCAGGAGAAGGG
CAGCTCACCTGCTGAAGTTTCCTGATGCGAAGATTATAAGCCTTGGGATCGGTGACACTA
CAGAGCCCATTCCAGACGTCATAACTAATGCCATGGCAAAGAGAGCACATGCTTTATCCA
CAGTTGATGGTTATAGTGGTTATGGAGCTGAACAGGGTGAAAAGAAACTAAGGGCAGCTA
TTGCTGCAACCTACTATGCGGATCTTGGTATTGAAGAAACAGATATATTCGTCTCTGATG
GTGCAAAATGTGACATTTCTCGTCTGCAGGTCCTTTTTGGATCTAATGTGAAGATTGCAG
TTCAAGATCCATCATATCCTGCCTATGTTGATTCAAGTGTTATCATGGGGCAAACTGGTT
TATATCAGGAGGATGTTCAGAAGTATGGAAATATTGAGTACATGAAATGCAGTCCTGAAA
ATGGGTTTTTCCCTGATCTGTCAAGTGTTCCACGAACAGATATAATCTTCTTTTGTTCAC
CCAACAATCCTACTGGTGCTGCTGCATCTCGGGACCAATTAACCAAATTAGTCAAATTTG
CAAAGGACAATGGATCCATTATAGTTTATGATTCTGCTTATGCCATGTACATATCAGATG
ACAGCCCAAAATCTATCTTTGAAATTCCTGGAGCAAAGGAGGTTGCCATTGAAACAGCAT
CTTTCTCCAAATATGCTGGATTCACTGGTGTGCGTTTGGGTTGGACTGTGGTTCCTAAGG
AGCTCCTTTTCTCAGATGGGCATCCTGTTGCTAAAGATTTCAACCGCATAGTCTGCACTT
GCTTCAATGGTGCATCAAACATTTCTCAAGCCGGTGGTTTAGGTTGTCTATCTCCAGAGG
GTCTAAAGGCCATGAGTGACGTTGTCGGCTTCTACAAGGAAAATACTAAAATTATTGTTG
ACACATTTACATCACTTGGATTCAACGTCTACGGTGCCAAGAATGCTCCATATGTGTGGG
TGCACTTCCCTGGCCGTAATTCTTGGGATGTCTTCGCCGAAATTCTTGAGAAGGCACATG
TGGTTACTACTCCTGGTAGCGGATTTGGGCCCGGTGGTGAAGGCTTCGTAAGGGTCAGTG
CATTTGGGCACAGAGAGAACATTATTGAAGCTGCGAGAAGACTGAAGCAGCTGTACAAAT
GAGCAGTGATCCGGCCTTTATATTCTCAACCTCTTGGGGAGCCATATCAAATAAAACCAA
GCAGAGTTCGAAGACAAAATTTACTCTGTCGGGCTATCAGTAGATGTTAGAATTGAAACC
TAATACTTTATAGGCAGTTGTTCTGTTCCGCTCGGTATTTATCCATTCAGAGCCATTTTA
CATTCTGAACTTCTCTTGTTGTTTAGCCCTGATGCACCTGAGTGAATCGCAAGCTTATTT
ATCTCCTTTTGCTAAGTTCGTTTCTACTACTCTGCTTAATTTGCTGCTGCCGTATAAGGC
TCAGTGATATCTCCCTGGATGCATTGAAACGTTAGGCACACTTGAGTC

CDS

1395 bp

>Os03t0299900-01 Similar to Plastid aminotransferase (Fragment).
ATGGCCGCCTCCCCCGCCGCCGGGGCCGCGGCCGCCACCGTCTCGTCGTTCGTCTCGCCG
TCGTCCTTCTCCTCCGTCAAGGCATCGAAGCCCGACCGCCTCCGTCCGGCGAGGAGGGCG
GCGGCCGTCAACGTCCGATGCGTCAGCAGCCCTCCGGCCACCGAAACTTCTTTCAAGACG
AAAGTACCACGAAATGCCAATATGGCCAAGCTGCAAGCTGGCTATCTGTTTCCTGAGATT
GCCAGGAGAAGGGCAGCTCACCTGCTGAAGTTTCCTGATGCGAAGATTATAAGCCTTGGG
ATCGGTGACACTACAGAGCCCATTCCAGACGTCATAACTAATGCCATGGCAAAGAGAGCA
CATGCTTTATCCACAGTTGATGGTTATAGTGGTTATGGAGCTGAACAGGGTGAAAAGAAA
CTAAGGGCAGCTATTGCTGCAACCTACTATGCGGATCTTGGTATTGAAGAAACAGATATA
TTCGTCTCTGATGGTGCAAAATGTGACATTTCTCGTCTGCAGGTCCTTTTTGGATCTAAT
GTGAAGATTGCAGTTCAAGATCCATCATATCCTGCCTATGTTGATTCAAGTGTTATCATG
GGGCAAACTGGTTTATATCAGGAGGATGTTCAGAAGTATGGAAATATTGAGTACATGAAA
TGCAGTCCTGAAAATGGGTTTTTCCCTGATCTGTCAAGTGTTCCACGAACAGATATAATC
TTCTTTTGTTCACCCAACAATCCTACTGGTGCTGCTGCATCTCGGGACCAATTAACCAAA
TTAGTCAAATTTGCAAAGGACAATGGATCCATTATAGTTTATGATTCTGCTTATGCCATG
TACATATCAGATGACAGCCCAAAATCTATCTTTGAAATTCCTGGAGCAAAGGAGGTTGCC
ATTGAAACAGCATCTTTCTCCAAATATGCTGGATTCACTGGTGTGCGTTTGGGTTGGACT
GTGGTTCCTAAGGAGCTCCTTTTCTCAGATGGGCATCCTGTTGCTAAAGATTTCAACCGC
ATAGTCTGCACTTGCTTCAATGGTGCATCAAACATTTCTCAAGCCGGTGGTTTAGGTTGT
CTATCTCCAGAGGGTCTAAAGGCCATGAGTGACGTTGTCGGCTTCTACAAGGAAAATACT
AAAATTATTGTTGACACATTTACATCACTTGGATTCAACGTCTACGGTGCCAAGAATGCT
CCATATGTGTGGGTGCACTTCCCTGGCCGTAATTCTTGGGATGTCTTCGCCGAAATTCTT
GAGAAGGCACATGTGGTTACTACTCCTGGTAGCGGATTTGGGCCCGGTGGTGAAGGCTTC
GTAAGGGTCAGTGCATTTGGGCACAGAGAGAACATTATTGAAGCTGCGAGAAGACTGAAG
CAGCTGTACAAATGA

Protein

465 aa

>Os03t0299900-01 Similar to Plastid aminotransferase (Fragment).
MAASPAAGAAAATVSSFVSPSSFSSVKASKPDRLRPARRAAAVNVRCVSSPPATETSFKT
KVPRNANMAKLQAGYLFPEIARRRAAHLLKFPDAKIISLGIGDTTEPIPDVITNAMAKRA
HALSTVDGYSGYGAEQGEKKLRAAIAATYYADLGIEETDIFVSDGAKCDISRLQVLFGSN
VKIAVQDPSYPAYVDSSVIMGQTGLYQEDVQKYGNIEYMKCSPENGFFPDLSSVPRTDII
FFCSPNNPTGAAASRDQLTKLVKFAKDNGSIIVYDSAYAMYISDDSPKSIFEIPGAKEVA
IETASFSKYAGFTGVRLGWTVVPKELLFSDGHPVAKDFNRIVCTCFNGASNISQAGGLGC
LSPEGLKAMSDVVGFYKENTKIIVDTFTSLGFNVYGAKNAPYVWVHFPGRNSWDVFAEIL
EKAHVVTTPGSGFGPGGEGFVRVSAFGHRENIIEAARRLKQLYK*

5'UTR

chr03:10542880..10542926 (+ strand) : 47 bp

CDS

chr03:10542927..10543006 (+ strand) : 80 bp

chr03:10543103..10543191 (+ strand) : 89 bp

chr03:10543446..10543513 (+ strand) : 68 bp

chr03:10543624..10543740 (+ strand) : 117 bp

chr03:10544039..10544101 (+ strand) : 63 bp

chr03:10544509..10544613 (+ strand) : 105 bp

chr03:10544691..10544741 (+ strand) : 51 bp

chr03:10544916..10545236 (+ strand) : 321 bp

chr03:10545337..10545543 (+ strand) : 207 bp

chr03:10545622..10545915 (+ strand) : 294 bp

3'UTR

chr03:10545916..10546261 (+ strand) : 346 bp

FASTA

>Os03t0299900-01 class=Sequence position=chr03:10542880..10546261 (+ strand)
AATCCGACCC GCGCCGCCGC CACCTCTTCC TCCGCTGCCC AAGAGCGATG GCCGCCTCCC CCGCCGCCGG GGCCGCGGCC
GCCACCGTCT CGTCGTTCGT CTCGCCGTCG TCCTTCTCCT CCGTCAAGTA ATCCAGTCAT CTCCGCGCGC GCGCGCGCTC
GCGCTTCGTT GATTGATTCG TTGTGCTGTG GTTCTCACTC TGTTTGGGCG TGATTGTTTA CAGGGCATCG AAGCCCGACC
GCCTCCGTCC GGCGAGGAGG GCGGCGGCCG TCAACGTCCG ATGCGTCAGC AGCCCTCCGG CCACCGAAAC TTGTACCGTC
CTCTCCCTTT CCCTCTCCCT CTCCCTCCTA GCAACTCATT TATGGTTGCT CCCAAACTGC TCACTGCCGC TTAGTAGGTT
TTTGCTATAG TAGTTATCGT TGGAGGTGTG CAATCGAATG CAATGAGCTC GATATTGCCT CCGCTGATGC TATCACACGC
AGTTTAGGAA CAACCAGAAA GTTACTGATA CTATCACTAG CACTGTGGTA GTAAGTTTAC TGAAAGATTC AGCTTTCGTT
TTGAAGCTTT CAAGACGAAA GTACCACGAA ATGCCAATAT GGCCAAGCTG CAAGCTGGCT ATCTGTTTCC TGAGGTTTGT
TTTGTTCCAA CCATTTCCTC TCTCTTCTTT CCCTCCCTGT CTTCGTTGAT GCTGTTTTAT TGAAATTGCA TGTTGATATT
GGTTCTTTGC CAACTGTGGA GCAGATTGCC AGGAGAAGGG CAGCTCACCT GCTGAAGTTT CCTGATGCGA AGATTATAAG
CCTTGGGATC GGTGACACTA CAGAGCCCAT TCCAGACGTC ATAACTAATG CCATGGCAAA GGTACATCGT TGCTCTTAAT
ATAATAAACA CCGGTTGTGT AGCTTCAGAT GATTTATGTT GCAGTTTGTC AAGATCGTAG TTAAATTTCT TATTGAAAAA
AGAAGTTCGG CATTGCATGG CACACAGTTC TTATGGTTCA ATGTAAATGA TTTTGTCAGA CAGGCTGTGC ATCTTCCTAG
GAGTAAACTA AGAAATCATC ATCTTCTTTT CTTTTTTCTT TTTTTTTTGC ATTTTTTGTA TTATAGTTAT TTTTTTTCAA
ATAAACATTG ATCTTTGATG GGTCTATTTG TAAATGCAGA GAGCACATGC TTTATCCACA GTTGATGGTT ATAGTGGTTA
TGGAGCTGAA CAGGGTGAAA AGGTATGCTT ATCACTTTAC TAGCATTTTC TGCCAATACA TCAGCATTCA GTTGACAAGA
TTGTACATAA CTATTTTGCT TCATATATGA TTTTAAAGTT TGTGTAGAAT ATTCTAGAAT AATTGGAGCA GGATAGATCT
TTGTGCTAAT CCATGAGGTT CAGTAACACC TTATGGCATC TGCTGGTGTG GTTCATCGAA TTAGTTTTTT GAACTATTAA
CTTCTTGCAC TAATAGCTGT CACAAAGATC AAACATCTGC CACATTTTCT TGATGAGTGG ATTCTTACTT TTCTTTTACT
GCCCCATTCA AATATATTAG TCTTGACATT GCATACATTT CATATAGCTT CACTATCATA AGCCGTTTAT GTTCATCATT
CTGAAATTAT ACATTAATTT TCTGCACAGA AACTAAGGGC AGCTATTGCT GCAACCTACT ATGCGGATCT TGGTATTGAA
GAAACAGATA TATTCGTCTC TGATGGTGCA AAATGTGACA TTTCTCGTCT GCAGGTTCTG AAATAATCCT ATCCTCCCTT
TCAGTTTATC ATTCATGCTA TAATGTCCCT TACATTTCTT CCAATTTTCA GGTCCTTTTT GGATCTAATG TGAAGATTGC
AGTTCAAGAT CCATCATATC CTGTATGAAA ATTCTTCACT TGATGTTAAC CCTTCCTAGT GCATGATTCC ATTCTTAAAC
TGATGTTTAT GGTCATGTGC TCCTTTTTTT TCATTTCTAT CATACTGCTT CTTATTACTA ACTATTACTT TCACACTTGT
CTGATGTGTA TTCCAACATG TGTTCCATTT TTATAGGCCT ATGTTGATTC AAGTGTTATC ATGGGGCAAA CTGGTTTATA
TCAGGAGGAT GTTCAGAAGT ATGGAAATAT TGAGTACATG AAATGCAGTC CTGAAAATGG GTTTTTCCCT GATCTGTCAA
GTGTTCCACG AACAGATATA ATCTTCTTTT GTTCACCCAA CAATCCTACT GGTGCTGCTG CATCTCGGGA CCAATTAACC
AAATTAGTCA AATTTGCAAA GGACAATGGA TCCATTATAG TTTATGATTC TGCTTATGCC ATGTACATAT CAGATGACAG
CCCAAAATCT ATCTTTGAAA TTCCTGGAGC AAAGGAGGTA GGCTTTGGGA TTTAAGCCCT TCCTACCACA TATGGAAATT
TATGGATTTT CTGCAAATAC TTAAATCCAC ACCTGTCATG TGTTTTCTTG TGTGTAGGTT GCCATTGAAA CAGCATCTTT
CTCCAAATAT GCTGGATTCA CTGGTGTGCG TTTGGGTTGG ACTGTGGTTC CTAAGGAGCT CCTTTTCTCA GATGGGCATC
CTGTTGCTAA AGATTTCAAC CGCATAGTCT GCACTTGCTT CAATGGTGCA TCAAACATTT CTCAAGCCGG TGGTTTAGGT
TGTCTATCTC CAGAGGGTCT AAAGGTAGCG TTTCAGAGTT TCTGAAAATC TTCATGTGGC TCTTTTGGCA ATGCTTCATT
TCATCTCTTT GTTCCTATGC AGGCCATGAG TGACGTTGTC GGCTTCTACA AGGAAAATAC TAAAATTATT GTTGACACAT
TTACATCACT TGGATTCAAC GTCTACGGTG CCAAGAATGC TCCATATGTG TGGGTGCACT TCCCTGGCCG TAATTCTTGG
GATGTCTTCG CCGAAATTCT TGAGAAGGCA CATGTGGTTA CTACTCCTGG TAGCGGATTT GGGCCCGGTG GTGAAGGCTT
CGTAAGGGTC AGTGCATTTG GGCACAGAGA GAACATTATT GAAGCTGCGA GAAGACTGAA GCAGCTGTAC AAATGAGCAG
TGATCCGGCC TTTATATTCT CAACCTCTTG GGGAGCCATA TCAAATAAAA CCAAGCAGAG TTCGAAGACA AAATTTACTC
TGTCGGGCTA TCAGTAGATG TTAGAATTGA AACCTAATAC TTTATAGGCA GTTGTTCTGT TCCGCTCGGT ATTTATCCAT
TCAGAGCCAT TTTACATTCT GAACTTCTCT TGTTGTTTAG CCCTGATGCA CCTGAGTGAA TCGCAAGCTT ATTTATCTCC
TTTTGCTAAG TTCGTTTCTA CTACTCTGCT TAATTTGCTG CTGCCGTATA AGGCTCAGTG ATATCTCCCT GGATGCATTG
AAACGTTAGG CACACTTGAG TC

Locus: Os03g0299900

Loading...

Locus: Os03g0299900

Loading...