Os03t0307700-00

Locus

Os03g0307700

Description

Domain of unknown function DUF231, plant domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL28, TBL28

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 28

Transcript Evidence

AK376385 (DDBJ)

Protein Evidence

NP_001049898.2 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Expression Databases

TENOR (Os03t0307700-00)

Others

Oryzabase (21483)

Transcript

1894 bp

>Os03t0307700-00 Domain of unknown function DUF231, plant domain containing protein.
AATGGACAGGCAGAGGAGCAGTGGCTCGTCGTCCACCTCGCACTACGGCGTCGTGAGCCC
CAAGGGCCTCATCCTCCTCTCCTTCGCCTCCTCCTCCCTCCTCTTCTCCTTCCTCTTCTC
CCTCTTCGCCCTCCGCTTCGGCCGCCCGCTCCACCTCCCCTTCGTCGCCTCCTCCTCCCT
CGCCGGGAACGCCTCCGCCATTGCGCGGGGCCCGGTTCTTGCTGCAGGTGGTGGGGGCCG
CTCCACGAGCGGCGCGGCGGTGGATGTTCTTCCGGGCAGGGGCAGGAGCGGGAGCTTGGG
GGAAGCAGCCCGCCGCTCGGATGCCGGAGGTTTTCCGTCCGCGGGAGGCGTGGGTTCCGC
AATGGAGGTGAAAGAGGCGGCACTGGGAAGCGAAAACGGCGGAGCTCCTGCCAATGGTGA
TTCCGGTTCGGCCATGGGGGCGGAAGGAGCTCCTGCTGGAGGTGGGGATGGCAACTCCGC
AGAAGGCGAGAATACCACCAAAGAAGTTGCCGATTCGGCGATGGAGACGAACCTACTTGT
TAGCAATGCATCCGCTTCGCAAGAAGCAGCCGCTCCAGCAGAGGAACCGAAGAAACCCAA
GTCTGTGCAAGATGTCGATTCCTCCATGGGAGATTCAGACCTCGGGTCGAACGGTGAATT
CTTGCAGGGAGAAAGTGGAAATTCCTCTGCAGGAGCACATACTTCTCAACGAGTGGATCA
AGGGGAACATTCAGCTCATTCGACAGTGAGGAACAGCTCTGGAGCAGCTCCACTCAGTTC
AAGCAAGCAAAAGACTGACCTGGTTCAGGAAACGGTGGATAGCAAGGTGGATGCGGCGAG
AAGCGATGCGGCACTATGCAATGTCTATGATGGAAGGTGGGTGTTCGATGAGAGCTATCC
ACTTTACACGAGTGATTCTTGCCCGTTCATAGATGAAGGATTCAGCTGCGAAGCAAATGG
AAGAATGGATGGAAGCTACAGGAAGTGGAGGTGGCAGCCAACTCATTGCAGTATACCGAG
GTTTGATGCTAGGAAAATGCTTGAGATGTTGCGAGGAAAACGGCTAGTGTTTGTCGGAGA
CTCCATTAACAGAAATCAGTGGGAATCCATGATGTGCTTGCTGAGAGGGGCAGTCTCAGA
TCCTGCAAGGATTCATGAAGCTCGAGGCCGCAGGATTACTAAGGAGAGAGGAGATTACAA
CTTCAAGTTTTTGGATTACAATTGCAGTGTGGAGTACCATGTGACGCATTTCTTGGTGCA
TGAAGGCAAAGCAAGAATTGGCTCAAAGCGCACGAGGACACTATGGATCGATACTGTTGA
TCGCACCTCGTCAAAATGGAGAGGTGCTGATGTTCTTGTGTTCAACACTGCTCATTGGTG
GTCGCATCACAAAACAAAAGCTGGAGTGAACTACTATCAAGAAGGTGATCATGTATATCC
CCATCTCGATGCTTCCACAGCTTACCTTAAAGCACTAACCACATGGGCATCATGGGTCGA
CCATTACATCAATCCAAGGAAAACTCGAGTGTTCTTCCGAAGCTCATCCCCGTCGCATTT
CAGCGGCGGGGAGTGGAATTCAGGGGGACACTGCAGAGAGAGCACACTGCCTCTCAGTGA
CACTCGTGTAAGGCCGGTGCCTGAGATAAACATGATCTTGGAGCAAGTAGCACAGCAAAT
GAAGACTTCTGTGACAATTCTGAACATTACCAATCTATCTGGGCTCAGGATAGATGGGCA
TCCATCTGTGTATGGGAGGAAGGCAGTGGTAGGTTTGACAGCATCGAGCGTTCAGGATTG
CAGCCACTGGTGCCTTCCTGGAGTGCCAGATACATGGAATGAGCTGCTGTTCTACCATCT
GGTATCCTCACAACAAAAGGGTGTAACAAGCTAG

CDS

1893 bp

>Os03t0307700-00 Domain of unknown function DUF231, plant domain containing protein.
ATGGACAGGCAGAGGAGCAGTGGCTCGTCGTCCACCTCGCACTACGGCGTCGTGAGCCCC
AAGGGCCTCATCCTCCTCTCCTTCGCCTCCTCCTCCCTCCTCTTCTCCTTCCTCTTCTCC
CTCTTCGCCCTCCGCTTCGGCCGCCCGCTCCACCTCCCCTTCGTCGCCTCCTCCTCCCTC
GCCGGGAACGCCTCCGCCATTGCGCGGGGCCCGGTTCTTGCTGCAGGTGGTGGGGGCCGC
TCCACGAGCGGCGCGGCGGTGGATGTTCTTCCGGGCAGGGGCAGGAGCGGGAGCTTGGGG
GAAGCAGCCCGCCGCTCGGATGCCGGAGGTTTTCCGTCCGCGGGAGGCGTGGGTTCCGCA
ATGGAGGTGAAAGAGGCGGCACTGGGAAGCGAAAACGGCGGAGCTCCTGCCAATGGTGAT
TCCGGTTCGGCCATGGGGGCGGAAGGAGCTCCTGCTGGAGGTGGGGATGGCAACTCCGCA
GAAGGCGAGAATACCACCAAAGAAGTTGCCGATTCGGCGATGGAGACGAACCTACTTGTT
AGCAATGCATCCGCTTCGCAAGAAGCAGCCGCTCCAGCAGAGGAACCGAAGAAACCCAAG
TCTGTGCAAGATGTCGATTCCTCCATGGGAGATTCAGACCTCGGGTCGAACGGTGAATTC
TTGCAGGGAGAAAGTGGAAATTCCTCTGCAGGAGCACATACTTCTCAACGAGTGGATCAA
GGGGAACATTCAGCTCATTCGACAGTGAGGAACAGCTCTGGAGCAGCTCCACTCAGTTCA
AGCAAGCAAAAGACTGACCTGGTTCAGGAAACGGTGGATAGCAAGGTGGATGCGGCGAGA
AGCGATGCGGCACTATGCAATGTCTATGATGGAAGGTGGGTGTTCGATGAGAGCTATCCA
CTTTACACGAGTGATTCTTGCCCGTTCATAGATGAAGGATTCAGCTGCGAAGCAAATGGA
AGAATGGATGGAAGCTACAGGAAGTGGAGGTGGCAGCCAACTCATTGCAGTATACCGAGG
TTTGATGCTAGGAAAATGCTTGAGATGTTGCGAGGAAAACGGCTAGTGTTTGTCGGAGAC
TCCATTAACAGAAATCAGTGGGAATCCATGATGTGCTTGCTGAGAGGGGCAGTCTCAGAT
CCTGCAAGGATTCATGAAGCTCGAGGCCGCAGGATTACTAAGGAGAGAGGAGATTACAAC
TTCAAGTTTTTGGATTACAATTGCAGTGTGGAGTACCATGTGACGCATTTCTTGGTGCAT
GAAGGCAAAGCAAGAATTGGCTCAAAGCGCACGAGGACACTATGGATCGATACTGTTGAT
CGCACCTCGTCAAAATGGAGAGGTGCTGATGTTCTTGTGTTCAACACTGCTCATTGGTGG
TCGCATCACAAAACAAAAGCTGGAGTGAACTACTATCAAGAAGGTGATCATGTATATCCC
CATCTCGATGCTTCCACAGCTTACCTTAAAGCACTAACCACATGGGCATCATGGGTCGAC
CATTACATCAATCCAAGGAAAACTCGAGTGTTCTTCCGAAGCTCATCCCCGTCGCATTTC
AGCGGCGGGGAGTGGAATTCAGGGGGACACTGCAGAGAGAGCACACTGCCTCTCAGTGAC
ACTCGTGTAAGGCCGGTGCCTGAGATAAACATGATCTTGGAGCAAGTAGCACAGCAAATG
AAGACTTCTGTGACAATTCTGAACATTACCAATCTATCTGGGCTCAGGATAGATGGGCAT
CCATCTGTGTATGGGAGGAAGGCAGTGGTAGGTTTGACAGCATCGAGCGTTCAGGATTGC
AGCCACTGGTGCCTTCCTGGAGTGCCAGATACATGGAATGAGCTGCTGTTCTACCATCTG
GTATCCTCACAACAAAAGGGTGTAACAAGCTAG

Protein

631 aa

>Os03t0307700-00 Domain of unknown function DUF231, plant domain containing protein.
MDRQRSSGSSSTSHYGVVSPKGLILLSFASSSLLFSFLFSLFALRFGRPLHLPFVASSSL
AGNASAIARGPVLAAGGGGRSTSGAAVDVLPGRGRSGSLGEAARRSDAGGFPSAGGVGSA
MEVKEAALGSENGGAPANGDSGSAMGAEGAPAGGGDGNSAEGENTTKEVADSAMETNLLV
SNASASQEAAAPAEEPKKPKSVQDVDSSMGDSDLGSNGEFLQGESGNSSAGAHTSQRVDQ
GEHSAHSTVRNSSGAAPLSSSKQKTDLVQETVDSKVDAARSDAALCNVYDGRWVFDESYP
LYTSDSCPFIDEGFSCEANGRMDGSYRKWRWQPTHCSIPRFDARKMLEMLRGKRLVFVGD
SINRNQWESMMCLLRGAVSDPARIHEARGRRITKERGDYNFKFLDYNCSVEYHVTHFLVH
EGKARIGSKRTRTLWIDTVDRTSSKWRGADVLVFNTAHWWSHHKTKAGVNYYQEGDHVYP
HLDASTAYLKALTTWASWVDHYINPRKTRVFFRSSSPSHFSGGEWNSGGHCRESTLPLSD
TRVRPVPEINMILEQVAQQMKTSVTILNITNLSGLRIDGHPSVYGRKAVVGLTASSVQDC
SHWCLPGVPDTWNELLFYHLVSSQQKGVTS*

5'UTR

chr03:10949519..10949519 (+ strand) : 1 bp

CDS

chr03:10949520..10950538 (+ strand) : 1019 bp

chr03:10950630..10950822 (+ strand) : 193 bp

chr03:10950908..10951098 (+ strand) : 191 bp

chr03:10951260..10951418 (+ strand) : 159 bp

chr03:10951502..10951832 (+ strand) : 331 bp

FASTA

>Os03t0307700-00 class=Sequence position=chr03:10949519..10951832 (+ strand)
AATGGACAGG CAGAGGAGCA GTGGCTCGTC GTCCACCTCG CACTACGGCG TCGTGAGCCC CAAGGGCCTC ATCCTCCTCT
CCTTCGCCTC CTCCTCCCTC CTCTTCTCCT TCCTCTTCTC CCTCTTCGCC CTCCGCTTCG GCCGCCCGCT CCACCTCCCC
TTCGTCGCCT CCTCCTCCCT CGCCGGGAAC GCCTCCGCCA TTGCGCGGGG CCCGGTTCTT GCTGCAGGTG GTGGGGGCCG
CTCCACGAGC GGCGCGGCGG TGGATGTTCT TCCGGGCAGG GGCAGGAGCG GGAGCTTGGG GGAAGCAGCC CGCCGCTCGG
ATGCCGGAGG TTTTCCGTCC GCGGGAGGCG TGGGTTCCGC AATGGAGGTG AAAGAGGCGG CACTGGGAAG CGAAAACGGC
GGAGCTCCTG CCAATGGTGA TTCCGGTTCG GCCATGGGGG CGGAAGGAGC TCCTGCTGGA GGTGGGGATG GCAACTCCGC
AGAAGGCGAG AATACCACCA AAGAAGTTGC CGATTCGGCG ATGGAGACGA ACCTACTTGT TAGCAATGCA TCCGCTTCGC
AAGAAGCAGC CGCTCCAGCA GAGGAACCGA AGAAACCCAA GTCTGTGCAA GATGTCGATT CCTCCATGGG AGATTCAGAC
CTCGGGTCGA ACGGTGAATT CTTGCAGGGA GAAAGTGGAA ATTCCTCTGC AGGAGCACAT ACTTCTCAAC GAGTGGATCA
AGGGGAACAT TCAGCTCATT CGACAGTGAG GAACAGCTCT GGAGCAGCTC CACTCAGTTC AAGCAAGCAA AAGACTGACC
TGGTTCAGGA AACGGTGGAT AGCAAGGTGG ATGCGGCGAG AAGCGATGCG GCACTATGCA ATGTCTATGA TGGAAGGTGG
GTGTTCGATG AGAGCTATCC ACTTTACACG AGTGATTCTT GCCCGTTCAT AGATGAAGGA TTCAGCTGCG AAGCAAATGG
AAGAATGGAT GGAAGCTACA GGAAGTGGAG GTGGCAGCCA ACTCATTGCA GTATACCGAG GTGCTGCGTT ACGGTGCATT
CGTGCAGTTT ATCGATTGCT TAGGTTATTG AGCTCAACAT TTGCTGACTT TGGAATGCAA TGAAATTTTA GGTTTGATGC
TAGGAAAATG CTTGAGATGT TGCGAGGAAA ACGGCTAGTG TTTGTCGGAG ACTCCATTAA CAGAAATCAG TGGGAATCCA
TGATGTGCTT GCTGAGAGGG GCAGTCTCAG ATCCTGCAAG GATTCATGAA GCTCGAGGCC GCAGGATTAC TAAGGAGAGA
GGAGATTACA ACTTCAAGTT TTTGGTTTGT ATGATCTAAT TTCTACTGTT GGAATATGTT CGGTGTTTGA ATTCGGTACA
CAATATTTAT CTCGGTAAGG TTGCCGCAGG ATTACAATTG CAGTGTGGAG TACCATGTGA CGCATTTCTT GGTGCATGAA
GGCAAAGCAA GAATTGGCTC AAAGCGCACG AGGACACTAT GGATCGATAC TGTTGATCGC ACCTCGTCAA AATGGAGAGG
TGCTGATGTT CTTGTGTTCA ACACTGCTCA TTGGTGGTCG CATCACAAAA CAAAAGCTGG GTGAGTGTTT ATAAATAGGG
GCAATAATGA ATCATTCACC CCTTACCGTG GTACAACCAA ATTGATCGGT AAATGCAGCT ATTGACATTT TTTTTAGGCC
ATGTTATTAT ATAGATGTAG CAGCTTAATG ATAGCCTCTT ACAGCTGCAT TTCATTTTCA GAGTGAACTA CTATCAAGAA
GGTGATCATG TATATCCCCA TCTCGATGCT TCCACAGCTT ACCTTAAAGC ACTAACCACA TGGGCATCAT GGGTCGACCA
TTACATCAAT CCAAGGAAAA CTCGAGTGTT CTTCCGAAGC TCATCCCCGT CGCATTTCAG GTTTGCTTCC TCATCTGTTC
AATTGTAGCA CTAGAAACTT GATGCGGTAA CATAGCAACT TATTGTCTTA TCCATGAGTT CAGCGGCGGG GAGTGGAATT
CAGGGGGACA CTGCAGAGAG AGCACACTGC CTCTCAGTGA CACTCGTGTA AGGCCGGTGC CTGAGATAAA CATGATCTTG
GAGCAAGTAG CACAGCAAAT GAAGACTTCT GTGACAATTC TGAACATTAC CAATCTATCT GGGCTCAGGA TAGATGGGCA
TCCATCTGTG TATGGGAGGA AGGCAGTGGT AGGTTTGACA GCATCGAGCG TTCAGGATTG CAGCCACTGG TGCCTTCCTG
GAGTGCCAGA TACATGGAAT GAGCTGCTGT TCTACCATCT GGTATCCTCA CAACAAAAGG GTGTAACAAG CTAG