Os03t0310000-01

Locus

Os03g0310000

Description

Lipase, GDSL domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GELP46

CGSNL Gene Name

GDSL ESTERASE/LIPASE PROTEIN 46

Oryzabase Gene Symbol Synonym(s)

OsGELP46, OsGELP46a, OsGELP46b

Oryzabase Gene Name Synonym(s)

GDSL esterase/lipase protein 46

Transcript Evidence

AK060625 (DDBJ, Best hit)

Protein Evidence

Q10MF9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid metabolic process (GO:0006629)

Molecular Function: hydrolase activity, acting on ester bonds (GO:0016788)

Functional domain (InterPro)

Lipase, GDSL (IPR001087)

Full-length cDNA

001-026-G08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0310000-01)

RiceXPro (AK060625)

Others

Oryzabase (10996)

KEGG (Os03t0310000-01)

Transcript

1443 bp

>Os03t0310000-01 Lipase, GDSL domain containing protein.
ACCAGTACCACCACTAAAAATTAAAGTGAGCTAAGCCAACACTTTGGCGGCAGAAACTTG
CAGCTAAGCATTGTCCCTCCTCATCTGCAAAGGCAGAGGAGATACATTCTCTCGTCCTCT
TTCGCTTGATATCAAGTTATCAACAGTGCTCTCCTATCCGTGAGCCGTGCACAACTGCAC
ACGATGGTGTTGATTCGTCTTACTATGCTGATCTTTATCGCCATCCTCCTTGCCGGCCGC
ACATGCGTACTTGTTGTTGCCGGCGGTGGAAtgccggcaaccttcgtgttcggtgactcg
ctcgtcgacgccggcaacaacaactatctcgtctccctgtccaaggcaaactacccacca
aacggcatcgacttcgacggacaccagcccaccggccggtacaccaacggCCGCACCATC
GTGGATATACTAGGGCAGGAAATGTCGGGAGGATTTGTGCCGCCCTACCTGGCGCCGGAG
ACCGCCGGCGACGTCCTGCTTAAGGGCGTCAACTACGCGTCCGGCGGCGGAGGCATTCTG
AACCAAACCGGGAGCATCTTCGGTGGGCGCATCAATCTGGACGCCCAGATCGACAACTAC
GCCAACAACCGGCACGAGCTGATCAAGCGGCACGGGGAGTTGGAGGCGGTGACCCTGCTC
CGTGGCGCGCTCTTCTCGGTCACGATGGGATCCAACGATTTCATCAACAACTACCTCACC
CCAATCTTCGGCGTGCCGGAGCGCGCCGTGACGCCACCGGAGGTCTTCGTCGACGCCCTC
ATATCCAAATACCGGGAGCAGCTCATAaggctgtacctgctggacgcccgtaagatcgtg
gtggcgaacgttgggccgatcgggtgcatcccgtacctgagggacacgacgccgacggtc
ggaacggcgtgcgccgagttccctaaccagcttgcccgcaacttcaacCGCAAGCTGCGC
GGCCTGGTGGACGAGCTGAGCGCCAACCTCACCGGCTCCCGCTTCCTCTACGCCGACGTC
TACCGCGTCTTCTCCGACATCATCGCCAACTACAAGTCGCACGGGTTCGAGGTGGCGGAC
TCGGCGTGCTGCTACGTGAGCGGGAGGTTCGGCGGGTTGCTGCCGTGCGGGCCGACGTCG
CAGTACTGCGCGGACAGGTCCAAGTACGTGTTCTGGGACCCGTACCACCCAAGCGACGCC
GCGAACGCGCTCATCGCCCGCCGGATCATCGACGGCGAGCCGGCGGACATCTTCCCGATC
AACGTGCGCCAGCTGATCACGAGCTGATACCGATAATTCGGTTGTAGTACTAGCCTTCAC
GGGCTAGGAGTAGTAGAAGGAACTTGCAGGATAGCTATTGATTTCTGTCCGTTTGGACGC
ATATTTTGGGGAGACGCACTGATGGATATGTGCATGTGATGCCATTGATGGACTGTTCGA
TCT

CDS

1104 bp

>Os03t0310000-01 Lipase, GDSL domain containing protein.
ATGGTGTTGATTCGTCTTACTATGCTGATCTTTATCGCCATCCTCCTTGCCGGCCGCACA
TGCGTACTTGTTGTTGCCGGCGGTGGAAtgccggcaaccttcgtgttcggtgactcgctc
gtcgacgccggcaacaacaactatctcgtctccctgtccaaggcaaactacccaccaaac
ggcatcgacttcgacggacaccagcccaccggccggtacaccaacggCCGCACCATCGTG
GATATACTAGGGCAGGAAATGTCGGGAGGATTTGTGCCGCCCTACCTGGCGCCGGAGACC
GCCGGCGACGTCCTGCTTAAGGGCGTCAACTACGCGTCCGGCGGCGGAGGCATTCTGAAC
CAAACCGGGAGCATCTTCGGTGGGCGCATCAATCTGGACGCCCAGATCGACAACTACGCC
AACAACCGGCACGAGCTGATCAAGCGGCACGGGGAGTTGGAGGCGGTGACCCTGCTCCGT
GGCGCGCTCTTCTCGGTCACGATGGGATCCAACGATTTCATCAACAACTACCTCACCCCA
ATCTTCGGCGTGCCGGAGCGCGCCGTGACGCCACCGGAGGTCTTCGTCGACGCCCTCATA
TCCAAATACCGGGAGCAGCTCATAaggctgtacctgctggacgcccgtaagatcgtggtg
gcgaacgttgggccgatcgggtgcatcccgtacctgagggacacgacgccgacggtcgga
acggcgtgcgccgagttccctaaccagcttgcccgcaacttcaacCGCAAGCTGCGCGGC
CTGGTGGACGAGCTGAGCGCCAACCTCACCGGCTCCCGCTTCCTCTACGCCGACGTCTAC
CGCGTCTTCTCCGACATCATCGCCAACTACAAGTCGCACGGGTTCGAGGTGGCGGACTCG
GCGTGCTGCTACGTGAGCGGGAGGTTCGGCGGGTTGCTGCCGTGCGGGCCGACGTCGCAG
TACTGCGCGGACAGGTCCAAGTACGTGTTCTGGGACCCGTACCACCCAAGCGACGCCGCG
AACGCGCTCATCGCCCGCCGGATCATCGACGGCGAGCCGGCGGACATCTTCCCGATCAAC
GTGCGCCAGCTGATCACGAGCTGA

Protein

368 aa

>Os03t0310000-01 Lipase, GDSL domain containing protein.
MVLIRLTMLIFIAILLAGRTCVLVVAGGGMPATFVFGDSLVDAGNNNYLVSLSKANYPPN
GIDFDGHQPTGRYTNGRTIVDILGQEMSGGFVPPYLAPETAGDVLLKGVNYASGGGGILN
QTGSIFGGRINLDAQIDNYANNRHELIKRHGELEAVTLLRGALFSVTMGSNDFINNYLTP
IFGVPERAVTPPEVFVDALISKYREQLIRLYLLDARKIVVANVGPIGCIPYLRDTTPTVG
TACAEFPNQLARNFNRKLRGLVDELSANLTGSRFLYADVYRVFSDIIANYKSHGFEVADS
ACCYVSGRFGGLLPCGPTSQYCADRSKYVFWDPYHPSDAANALIARRIIDGEPADIFPIN
VRQLITS*

5'UTR

chr03:11059852..11060034 (+ strand) : 183 bp

CDS

chr03:11060035..11060284 (+ strand) : 250 bp

chr03:11060554..11060681 (+ strand) : 128 bp

chr03:11061004..11061249 (+ strand) : 246 bp

chr03:11061414..11061669 (+ strand) : 256 bp

chr03:11061777..11062000 (+ strand) : 224 bp

3'UTR

chr03:11062001..11062156 (+ strand) : 156 bp

FASTA

>Os03t0310000-01 class=Sequence position=chr03:11059852..11062156 (+ strand)
ACCAGTACCA CCACTAAAAA TTAAAGTGAG CTAAGCCAAC ACTTTGGCGG CAGAAACTTG CAGCTAAGCA TTGTCCCTCC
TCATCTGCAA AGGCAGAGGA GATACATTCT CTCGTCCTCT TTCGCTTGAT ATCAAGTTAT CAACAGTGCT CTCCTATCCG
TGAGCCGTGC ACAACTGCAC ACGATGGTGT TGATTCGTCT TACTATGCTG ATCTTTATCG CCATCCTCCT TGCCGGCCGC
ACATGCGTAC TTGTTGTTGC CGGCGGTGGA Atgccggcaa ccttcgtgtt cggtgactcg ctcgtcgacg ccggcaacaa
caactatctc gtctccctgt ccaaggcaaa ctacccacca aacggcatcg acttcgacgg acaccagccc accggccggt
acaccaacgg CCGCACCATC GTGGATATAC TAGGTGAGCA CATTAACTTG GTTTCTTACC TGAACTGCAC TATTCCATTG
CCTTTTTTTT GGAAAATACG GGGGGAAAAC ACTTATGCAT CGTTATGTTA GGATTAGGTG GAGATTTCTC AGATGATACA
ACGATCTGAC CTGCACGGAC GCATTAGATC ACCTAGGAAC AGGAGATATA GGCAAAAGCT AATTCTCACA GCAATGTTTA
CGATCTTCAT TGCCGGAACA TGCATGGCTA ATTGGGCTCA TAAACTTTGG TTTAATTTTC AGGGCAGGAA ATGTCGGGAG
GATTTGTGCC GCCCTACCTG GCGCCGGAGA CCGCCGGCGA CGTCCTGCTT AAGGGCGTCA ACTACGCGTC CGGCGGCGGA
GGCATTCTGA ACCAAACCGG GAGCATCTTC GTCAGTTCAC TAAACTAGTC ATTTTTTCGT GTGAAATCCT ACTCTGCTTT
TCGTTTTTTT TTAAAAAAAA ATGCACTTGT TCCCGCGTAA GTTGAGAAGA GAGATGATCA TTGCTTCTCC GTGATGCGCT
TCTTCCGTAG CCTCTCTCTT GCGTGAGTGC GGCAACTAAC AGTAACAGAT CAGATCGGAA TGCTGCCAGT TGACCGTTTT
TCTTTTTTGG CCTAGTTCAT CCTTCCATGA TCTTTTGCAG CTGGTAACGT TTTTAATCGA CCTGCCGACC GGTAACATAG
CGTATTTATA CGTGTGGATC TTGTTTTTGT AGGGTGGGCG CATCAATCTG GACGCCCAGA TCGACAACTA CGCCAACAAC
CGGCACGAGC TGATCAAGCG GCACGGGGAG TTGGAGGCGG TGACCCTGCT CCGTGGCGCG CTCTTCTCGG TCACGATGGG
ATCCAACGAT TTCATCAACA ACTACCTCAC CCCAATCTTC GGCGTGCCGG AGCGCGCCGT GACGCCACCG GAGGTCTTCG
TCGACGCCCT CATATCCAAA TACCGGGAGC AGCTCATAGT AAGTGCCATT GCCGGTTTGC CACAGATCAC ACAAGCTGTG
TGTGTTGGGC TCGAGGCTGC ACCCGTGCAC CGTACCTTTT TTCTCTGCAA GTAGCAGTAA TTCGAGAGGG GTAATTACTT
GTACTTAACC GTGGggcgcg cgtgcgattc aatgtgtggc agaggctgta cctgctggac gcccgtaaga tcgtggtggc
gaacgttggg ccgatcgggt gcatcccgta cctgagggac acgacgccga cggtcggaac ggcgtgcgcc gagttcccta
accagcttgc ccgcaacttc aacCGCAAGC TGCGCGGCCT GGTGGACGAG CTGAGCGCCA ACCTCACCGG CTCCCGCTTC
CTCTACGCCG ACGTCTACCG CGTCTTCTCC GACATCATCG CCAACTACAA GTCGCACGGT AACATCCTTC TCCGTGGATT
TTTACCATCG AGAAAACGTT CCCTCGTTTT GTGCGTGCCA CGTTCTAATG ATTTTTTTTA TCACGTCGTC GTGTTGTTGT
GGCAGGGTTC GAGGTGGCGG ACTCGGCGTG CTGCTACGTG AGCGGGAGGT TCGGCGGGTT GCTGCCGTGC GGGCCGACGT
CGCAGTACTG CGCGGACAGG TCCAAGTACG TGTTCTGGGA CCCGTACCAC CCAAGCGACG CCGCGAACGC GCTCATCGCC
CGCCGGATCA TCGACGGCGA GCCGGCGGAC ATCTTCCCGA TCAACGTGCG CCAGCTGATC ACGAGCTGAT ACCGATAATT
CGGTTGTAGT ACTAGCCTTC ACGGGCTAGG AGTAGTAGAA GGAACTTGCA GGATAGCTAT TGATTTCTGT CCGTTTGGAC
GCATATTTTG GGGAGACGCA CTGATGGATA TGTGCATGTG ATGCCATTGA TGGACTGTTC GATCT