Os03t0320400-01

Locus

Os03g0320400

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET16, SDG713, OsSUVH3

Oryzabase Gene Name Synonym(s)

SET protein 16, SUVH Histone Methyltransferase 3

Transcript Evidence

AK100673 (DDBJ, Best hit)

Protein Evidence

Q9AT64 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Molecular Function: histone binding (GO:0042393)

Functional domain (InterPro)

SET domain (IPR001214)

SRA-YDG (IPR003105)

Pre-SET domain (IPR007728)

Full-length cDNA

J023112P17 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0320400-01)

RiceXPro (AK100673)

Others

Oryzabase (13381)

KEGG (Os03t0320400-01)

Transcript

2277 bp

>Os03t0320400-01 SET domain containing protein.
ACCCTGCACACCACCCTGTTGCTTCCCTACATCCGCTACTTGAGACTCCTCCCCTATCAC
CTATCTCTTCCTACCCCATCACATCCCGTCCTCGATCAGATACACCTCCTCTTGTCACTT
CCCTCTATCCATCCCATCTCCTTCACCAAGGCCACCACTCCCCCTCATCATCATCTCCTC
AACCACCCCGTGTGTGCACAATGGAAAGTAACCAACACAAAGCATCAGATCCACAGGATT
CTATGGTTCATTTAGATCTGGATGAAGATAAGATAATGGTGACATCAGCATTACCATGTC
CTTCAATGTCCGTGGGAAAATCGGTTATGAGGAAGAGGGGAAGACCAAGCAGGCATGCAC
GAGGAACTTCGTTGTCTTCTGTTACCCCAGAAGGGTGCAAGAAGATGGAGGGTCGATCAT
ATAATTTGCGTAGTGATTCAACAATTTTGTTGAGAAATTCATGTTTGCTAATAGCTGATG
GATCGACAAAACAGAAGCGATCTTGGGGACTTGACAAGGATGACTTGCATATACCTTTCT
TTCAAATTTCAGATAATCCTAGGGAAGCTGTTGATGATATACTCATGACATTTGGTGGAC
TACATCGGAGGATCATGCAGTTGATAGATGTGAAAATGGCTTCAAAACAGCTTGTCTTCC
AAGCATTGAACCTCATGAGAAAAGTTGGATATCATGTTAACAAGGACAAGAGGGTTGGAG
AGGTCCCAGGAGTTAAAATTGGTGACATATTCTACTCTAGAATTGAGATGCTCTTGGTAG
GGCTACATAGTAACATCAATAGAGGAATTGAATTCATGTCTGGTGCTTTTATTAATAAGG
AAGATAAGATAGCTACATGCATTGTGTCATCTGGAATGTATGAGAATGGTGATGATGACC
CATATACTTTGGTATATAATGGCCAAGGCAAAGTCCACCATAAGCTTGAGAGAGGTAACT
ATTCGTTGAATCAGAGttttattagaaggaatcatattagacttattcgtagtgaaccaa
atccattggttaggctaggctcaaaggaaaaaatatacatATATGATGGTCTTTATAAGA
TCGAAGAAAAGTACAGACAAACAACAAAATCTCGTTCTAACTTAAAGTTCAACAAGTTGG
TCAGGGAACTAGGCCAGCCTAATGGCATTGTAGTATGGAAGAATACTCAGAAATGGAGGG
AAAATCCATCTTGTAGAGATCATGTCATAATGCCTGACATGTCAAATGGTGCAGAAATAG
CTCGTGTTTGTGTTGTAAACAACATTGATAGTGAGGATGCTCCTAACAACTTTACCTATT
CAACTAAACTTGATAATGGGAATCATATGGTTTCAGCAAACAAGATGTGTGTCTGCAAAT
GCACAAGCTCATGCCTTGGTGAAGACAATTGCTCTTGTTTGAAAACAAATGGCAGCTATT
TACCTTACAACTCTTCAGGAATACTTGTTTGTCGAAAGACTATGATATATGAGTGCAATG
ATTCATGTGCTTGCACAATTAATTGCTCGAACCGAGTGGTACAGAGGGGTTCCTATCTAC
ACTTTGAAGTGTTCAAGACGATGGATCGAGGTTGGGGCCTTCGCAGTTGGGATCCCATTC
CGGCGGGTGCATTTGTATGTGAATATGTTGGTGTAGTTATTGACAAAGATAGCTTAGTTG
AAGAAGATGAATACATATTTGAGGTTACTAGACCAGAGCATAATTTAAAATGGAACTATT
TACCAGAATTGATAGGTGAACCTTCTTTCTATGACATGAATGATACATTCAAGAAGTTGt
gttaacaaccaaatttggtaatatcggcattgggaaagaagattagattgaagcgaagtc
ggaggcggagatcaagttcggaaacagagcagggattggctggagtccagattagctacg
ataagatcggctgagtctgagtcggactaggtaagccgatgtagccgatcctagcaatac
aacttgatgtgtgatgtcgggttggattgaggtgcttcaaggtgattgccgcacatggat
agagtcctgaggaggcaattgtatctattagttaggatgttttatgtaatttccttagag
atatgattgggcaaaagtctgccgcaaagacttatagtatcttagagtttgttagagata
gtagtcgtgtccgttatggacatatcttgtaattctcgggtataaatatacccgagccct
atgtaacttttaacacacgttcaatacaatctcggcgcatcgccacccttttacttt

CDS

1605 bp

>Os03t0320400-01 SET domain containing protein.
ATGGAAAGTAACCAACACAAAGCATCAGATCCACAGGATTCTATGGTTCATTTAGATCTG
GATGAAGATAAGATAATGGTGACATCAGCATTACCATGTCCTTCAATGTCCGTGGGAAAA
TCGGTTATGAGGAAGAGGGGAAGACCAAGCAGGCATGCACGAGGAACTTCGTTGTCTTCT
GTTACCCCAGAAGGGTGCAAGAAGATGGAGGGTCGATCATATAATTTGCGTAGTGATTCA
ACAATTTTGTTGAGAAATTCATGTTTGCTAATAGCTGATGGATCGACAAAACAGAAGCGA
TCTTGGGGACTTGACAAGGATGACTTGCATATACCTTTCTTTCAAATTTCAGATAATCCT
AGGGAAGCTGTTGATGATATACTCATGACATTTGGTGGACTACATCGGAGGATCATGCAG
TTGATAGATGTGAAAATGGCTTCAAAACAGCTTGTCTTCCAAGCATTGAACCTCATGAGA
AAAGTTGGATATCATGTTAACAAGGACAAGAGGGTTGGAGAGGTCCCAGGAGTTAAAATT
GGTGACATATTCTACTCTAGAATTGAGATGCTCTTGGTAGGGCTACATAGTAACATCAAT
AGAGGAATTGAATTCATGTCTGGTGCTTTTATTAATAAGGAAGATAAGATAGCTACATGC
ATTGTGTCATCTGGAATGTATGAGAATGGTGATGATGACCCATATACTTTGGTATATAAT
GGCCAAGGCAAAGTCCACCATAAGCTTGAGAGAGGTAACTATTCGTTGAATCAGAGtttt
attagaaggaatcatattagacttattcgtagtgaaccaaatccattggttaggctaggc
tcaaaggaaaaaatatacatATATGATGGTCTTTATAAGATCGAAGAAAAGTACAGACAA
ACAACAAAATCTCGTTCTAACTTAAAGTTCAACAAGTTGGTCAGGGAACTAGGCCAGCCT
AATGGCATTGTAGTATGGAAGAATACTCAGAAATGGAGGGAAAATCCATCTTGTAGAGAT
CATGTCATAATGCCTGACATGTCAAATGGTGCAGAAATAGCTCGTGTTTGTGTTGTAAAC
AACATTGATAGTGAGGATGCTCCTAACAACTTTACCTATTCAACTAAACTTGATAATGGG
AATCATATGGTTTCAGCAAACAAGATGTGTGTCTGCAAATGCACAAGCTCATGCCTTGGT
GAAGACAATTGCTCTTGTTTGAAAACAAATGGCAGCTATTTACCTTACAACTCTTCAGGA
ATACTTGTTTGTCGAAAGACTATGATATATGAGTGCAATGATTCATGTGCTTGCACAATT
AATTGCTCGAACCGAGTGGTACAGAGGGGTTCCTATCTACACTTTGAAGTGTTCAAGACG
ATGGATCGAGGTTGGGGCCTTCGCAGTTGGGATCCCATTCCGGCGGGTGCATTTGTATGT
GAATATGTTGGTGTAGTTATTGACAAAGATAGCTTAGTTGAAGAAGATGAATACATATTT
GAGGTTACTAGACCAGAGCATAATTTAAAATGGAACTATTTACCAGAATTGATAGGTGAA
CCTTCTTTCTATGACATGAATGATACATTCAAGAAGTTGtgttaa

Protein

535 aa

>Os03t0320400-01 SET domain containing protein.
MESNQHKASDPQDSMVHLDLDEDKIMVTSALPCPSMSVGKSVMRKRGRPSRHARGTSLSS
VTPEGCKKMEGRSYNLRSDSTILLRNSCLLIADGSTKQKRSWGLDKDDLHIPFFQISDNP
REAVDDILMTFGGLHRRIMQLIDVKMASKQLVFQALNLMRKVGYHVNKDKRVGEVPGVKI
GDIFYSRIEMLLVGLHSNINRGIEFMSGAFINKEDKIATCIVSSGMYENGDDDPYTLVYN
GQGKVHHKLERGNYSLNQSFIRRNHIRLIRSEPNPLVRLGSKEKIYIYDGLYKIEEKYRQ
TTKSRSNLKFNKLVRELGQPNGIVVWKNTQKWRENPSCRDHVIMPDMSNGAEIARVCVVN
NIDSEDAPNNFTYSTKLDNGNHMVSANKMCVCKCTSSCLGEDNCSCLKTNGSYLPYNSSG
ILVCRKTMIYECNDSCACTINCSNRVVQRGSYLHFEVFKTMDRGWGLRSWDPIPAGAFVC
EYVGVVIDKDSLVEEDEYIFEVTRPEHNLKWNYLPELIGEPSFYDMNDTFKKLC*

5'UTR

chr03:11560162..11560361 (+ strand) : 200 bp

CDS

chr03:11560362..11560554 (+ strand) : 193 bp

chr03:11560681..11562092 (+ strand) : 1412 bp

3'UTR

chr03:11562093..11562564 (+ strand) : 472 bp

FASTA

>Os03t0320400-01 class=Sequence position=chr03:11560162..11562564 (+ strand)
ACCCTGCACA CCACCCTGTT GCTTCCCTAC ATCCGCTACT TGAGACTCCT CCCCTATCAC CTATCTCTTC CTACCCCATC
ACATCCCGTC CTCGATCAGA TACACCTCCT CTTGTCACTT CCCTCTATCC ATCCCATCTC CTTCACCAAG GCCACCACTC
CCCCTCATCA TCATCTCCTC AACCACCCCG TGTGTGCACA ATGGAAAGTA ACCAACACAA AGCATCAGAT CCACAGGATT
CTATGGTTCA TTTAGATCTG GATGAAGATA AGATAATGGT GACATCAGCA TTACCATGTC CTTCAATGTC CGTGGGAAAA
TCGGTTATGA GGAAGAGGGG AAGACCAAGC AGGCATGCAC GAGGAACTTC GTTGTCTTCT GTTACCCCAG AAGGTAATAA
CATTGTTTCT TTAAGACCTT CCTTAGACAA ATTGGATATA TCTAGTCAAA GAAAGAGAGG AAGACTACCC AATCATGTGA
CATATAATTC AGAGGATCCT TCTCAAACTT GTATTGTAGG GTGCAAGAAG ATGGAGGGTC GATCATATAA TTTGCGTAGT
GATTCAACAA TTTTGTTGAG AAATTCATGT TTGCTAATAG CTGATGGATC GACAAAACAG AAGCGATCTT GGGGACTTGA
CAAGGATGAC TTGCATATAC CTTTCTTTCA AATTTCAGAT AATCCTAGGG AAGCTGTTGA TGATATACTC ATGACATTTG
GTGGACTACA TCGGAGGATC ATGCAGTTGA TAGATGTGAA AATGGCTTCA AAACAGCTTG TCTTCCAAGC ATTGAACCTC
ATGAGAAAAG TTGGATATCA TGTTAACAAG GACAAGAGGG TTGGAGAGGT CCCAGGAGTT AAAATTGGTG ACATATTCTA
CTCTAGAATT GAGATGCTCT TGGTAGGGCT ACATAGTAAC ATCAATAGAG GAATTGAATT CATGTCTGGT GCTTTTATTA
ATAAGGAAGA TAAGATAGCT ACATGCATTG TGTCATCTGG AATGTATGAG AATGGTGATG ATGACCCATA TACTTTGGTA
TATAATGGCC AAGGCAAAGT CCACCATAAG CTTGAGAGAG GTAACTATTC GTTGAATCAG AGttttatta gaaggaatca
tattagactt attcgtagtg aaccaaatcc attggttagg ctaggctcaa aggaaaaaat atacatATAT GATGGTCTTT
ATAAGATCGA AGAAAAGTAC AGACAAACAA CAAAATCTCG TTCTAACTTA AAGTTCAACA AGTTGGTCAG GGAACTAGGC
CAGCCTAATG GCATTGTAGT ATGGAAGAAT ACTCAGAAAT GGAGGGAAAA TCCATCTTGT AGAGATCATG TCATAATGCC
TGACATGTCA AATGGTGCAG AAATAGCTCG TGTTTGTGTT GTAAACAACA TTGATAGTGA GGATGCTCCT AACAACTTTA
CCTATTCAAC TAAACTTGAT AATGGGAATC ATATGGTTTC AGCAAACAAG ATGTGTGTCT GCAAATGCAC AAGCTCATGC
CTTGGTGAAG ACAATTGCTC TTGTTTGAAA ACAAATGGCA GCTATTTACC TTACAACTCT TCAGGAATAC TTGTTTGTCG
AAAGACTATG ATATATGAGT GCAATGATTC ATGTGCTTGC ACAATTAATT GCTCGAACCG AGTGGTACAG AGGGGTTCCT
ATCTACACTT TGAAGTGTTC AAGACGATGG ATCGAGGTTG GGGCCTTCGC AGTTGGGATC CCATTCCGGC GGGTGCATTT
GTATGTGAAT ATGTTGGTGT AGTTATTGAC AAAGATAGCT TAGTTGAAGA AGATGAATAC ATATTTGAGG TTACTAGACC
AGAGCATAAT TTAAAATGGA ACTATTTACC AGAATTGATA GGTGAACCTT CTTTCTATGA CATGAATGAT ACATTCAAGA
AGTTGtgtta acaaccaaat ttggtaatat cggcattggg aaagaagatt agattgaagc gaagtcggag gcggagatca
agttcggaaa cagagcaggg attggctgga gtccagatta gctacgataa gatcggctga gtctgagtcg gactaggtaa
gccgatgtag ccgatcctag caatacaact tgatgtgtga tgtcgggttg gattgaggtg cttcaaggtg attgccgcac
atggatagag tcctgaggag gcaattgtat ctattagtta ggatgtttta tgtaatttcc ttagagatat gattgggcaa
aagtctgccg caaagactta tagtatctta gagtttgtta gagatagtag tcgtgtccgt tatggacata tcttgtaatt
ctcgggtata aatatacccg agccctatgt aacttttaac acacgttcaa tacaatctcg gcgcatcgcc acccttttac
ttt

Locus: Os03g0320400

Loading...

Locus: Os03g0320400

Loading...