Os03t0327100-01

Locus

Os03g0327100

Description

Similar to CUC1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CUC1

CGSNL Gene Name

CUP SHAPED COTYLEDON 1

Oryzabase Gene Symbol Synonym(s)

ONAC039, ONAC39, NAC39, OsCUC1, DLN86, OsDLN86

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 039, NAC domain-containing protein 39, CUP SHAPED COTYLEDON1, DLN repressor 86, DLN motif protein 86

Transcript Evidence

AK065989 (DDBJ, Best hit)

Protein Evidence

NP_001147731.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J013046E14 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0327100-01)

RiceXPro (AK065989)

Others

Oryzabase (11479)

KEGG (Os03t0327100-01)

Transcript

1795 bp

>Os03t0327100-01 Similar to CUC1.
AACCCCAAGTCCATTCTCTCGTTCCCAAACCCTGCATCCTTCTCTTTCACACAAGCCTCT
CTCTCGCCGGCTTCGGCGTCCGTCTCCTCCTCCTCCTCTTCGTCTAGCCTTGTGGCGGCG
TGCGGTGCGGTGCGGTGAGGAAAGGAGGGAGCTTTGAAGGTCGGGGGAGGGCGGAGGAGA
TGTCTGAGGTGTCCGTTATGGCCGAGGTGGAGGAGACGGCGGCGGCGGCGCCGCTGGACC
TGCCGCCGGGGTTCAGGTTCCACCCCACCGACGAGGAGATCGTCTCGCACTACCTCACCC
CCAAGGCCCTCAACCACCGCTTCTCCTCCGGCGTCATCGGCGACGTCGACCTCAACAAGT
GCGAGCCATGGCACCTCCCAGCCATGgcgaagatgggggagaaggagtggtacttcttct
gccacaaggaccgcaagtacccgaccgggacgaggacgaaccgggcgacggagagcggct
actggaaggccaccggcaaggacaaggagatcttccgcgggaggggcatcctcgtcggca
tgaagaagacgctcgtcttctacctcggccgcgcgccccgtggcgagaagaccggctggg
tgatgcacgagttccgcctCGAGGGCAAGCTCCCCAGCCAGCTCCCGCGCTCCGCCAAGG
ACCAGTGGGCGGTGTGCAAGGTGTTCAACAAGGAGTTGGCGCTGGCGGCGAAGAACGGGC
CAATGGCGGTGACCGAAGCGACCGCCGACGACGCGGGGATCGAGCGGGTCGGCTCGTTCA
GCTTCCTCAGCGACTTCATCGACCCCGCCGAGCTGCCGCCGCTGATGGACCCTTCCTTCG
TCGCCGACATCGACGGGGTGGACGACGCCAAGGTGTCCGCGTCGACCTCCGGGCAGGCCG
CGATCGCCGCCGGCTTCCATGTCGCGTCGCAGGTCATGAGCTACCAGCAGGTCAAGATGG
AAGAGCCGTTGCCGCTGCCGTACCTGCACCAGCAGCCGCCGCGGATGCTGCACTCGGGTC
AGTACTTCTCGCTCCCGGCGGTGCACCCCGGCGACCTGACGCCGTCGGCGATCCGGAGGT
ACTGCAAGGCGGAGCAGGTCTCGGGGCAGACGTCGGCGCTCAGCGCCTCGCGCGACACCG
GGCTCAGCACCGACCCCAACGCCGCCGGCTGCGCGGAGATCTCGTCGGCGCCGACGTCCC
AGCCGTTCCCGGAGTTCGACGACGGGATTCTGGGCCTCGACGACTTCTGGAACTAATCCA
CGCCTGAATGATCCGGAGCTAGCTCCCTACCGACCTTGCGCTACAGGATTTTGCTTCAGG
CTGGTTGATTAATTACTTGATTTGATTAATTAACTTGGTGTTTCATGCTTGGGTTAATTA
GTGGCAGTTTGTTGATGCATCCTTCTCTTCCTCCTTCCGATCGAAGGCTTCTTCTCGGGA
TGGGTTCGGATGATCAGATTATTTATCATCCATCCAGACCTCCAGGGATTAGCTAGGACT
CCTTGTTAATTAATCCTAGCTAGCTAGGTTTCTTCATGTCTTGATCTGATGTAAATACAA
TTACTACTACTAAGTACGGGGTATCCTGATTGTGTCTAGTAGCATGATGATTGATTATAC
TACAATCAATGGGGTGTAGATTAGGGGTGGATTGATCATTTACGAATTGATTAATTTGGC
ATTTGATGAGCCAGCTAGCTGCTAGCTTTATAAAGCTTTATACTATGTACATGTACCATT
AATTGCTTGAGCTAGACATCTCATCATATGTGAATTGATGCTTCGGTTTAGCCTT

CDS

1077 bp

>Os03t0327100-01 Similar to CUC1.
ATGTCTGAGGTGTCCGTTATGGCCGAGGTGGAGGAGACGGCGGCGGCGGCGCCGCTGGAC
CTGCCGCCGGGGTTCAGGTTCCACCCCACCGACGAGGAGATCGTCTCGCACTACCTCACC
CCCAAGGCCCTCAACCACCGCTTCTCCTCCGGCGTCATCGGCGACGTCGACCTCAACAAG
TGCGAGCCATGGCACCTCCCAGCCATGgcgaagatgggggagaaggagtggtacttcttc
tgccacaaggaccgcaagtacccgaccgggacgaggacgaaccgggcgacggagagcggc
tactggaaggccaccggcaaggacaaggagatcttccgcgggaggggcatcctcgtcggc
atgaagaagacgctcgtcttctacctcggccgcgcgccccgtggcgagaagaccggctgg
gtgatgcacgagttccgcctCGAGGGCAAGCTCCCCAGCCAGCTCCCGCGCTCCGCCAAG
GACCAGTGGGCGGTGTGCAAGGTGTTCAACAAGGAGTTGGCGCTGGCGGCGAAGAACGGG
CCAATGGCGGTGACCGAAGCGACCGCCGACGACGCGGGGATCGAGCGGGTCGGCTCGTTC
AGCTTCCTCAGCGACTTCATCGACCCCGCCGAGCTGCCGCCGCTGATGGACCCTTCCTTC
GTCGCCGACATCGACGGGGTGGACGACGCCAAGGTGTCCGCGTCGACCTCCGGGCAGGCC
GCGATCGCCGCCGGCTTCCATGTCGCGTCGCAGGTCATGAGCTACCAGCAGGTCAAGATG
GAAGAGCCGTTGCCGCTGCCGTACCTGCACCAGCAGCCGCCGCGGATGCTGCACTCGGGT
CAGTACTTCTCGCTCCCGGCGGTGCACCCCGGCGACCTGACGCCGTCGGCGATCCGGAGG
TACTGCAAGGCGGAGCAGGTCTCGGGGCAGACGTCGGCGCTCAGCGCCTCGCGCGACACC
GGGCTCAGCACCGACCCCAACGCCGCCGGCTGCGCGGAGATCTCGTCGGCGCCGACGTCC
CAGCCGTTCCCGGAGTTCGACGACGGGATTCTGGGCCTCGACGACTTCTGGAACTAA

Protein

359 aa

>Os03t0327100-01 Similar to CUC1.
MSEVSVMAEVEETAAAAPLDLPPGFRFHPTDEEIVSHYLTPKALNHRFSSGVIGDVDLNK
CEPWHLPAMAKMGEKEWYFFCHKDRKYPTGTRTNRATESGYWKATGKDKEIFRGRGILVG
MKKTLVFYLGRAPRGEKTGWVMHEFRLEGKLPSQLPRSAKDQWAVCKVFNKELALAAKNG
PMAVTEATADDAGIERVGSFSFLSDFIDPAELPPLMDPSFVADIDGVDDAKVSASTSGQA
AIAAGFHVASQVMSYQQVKMEEPLPLPYLHQQPPRMLHSGQYFSLPAVHPGDLTPSAIRR
YCKAEQVSGQTSALSASRDTGLSTDPNAAGCAEISSAPTSQPFPEFDDGILGLDDFWN*

5'UTR

chr03:11939295..11939473 (- strand) : 179 bp

CDS

chr03:11939093..11939294 (- strand) : 202 bp

chr03:11938715..11938992 (- strand) : 278 bp

chr03:11937984..11938580 (- strand) : 597 bp

3'UTR

chr03:11937445..11937983 (- strand) : 539 bp

FASTA

>Os03t0327100-01 class=Sequence position=chr03:11937445..11939473 (- strand)
AACCCCAAGT CCATTCTCTC GTTCCCAAAC CCTGCATCCT TCTCTTTCAC ACAAGCCTCT CTCTCGCCGG CTTCGGCGTC
CGTCTCCTCC TCCTCCTCTT CGTCTAGCCT TGTGGCGGCG TGCGGTGCGG TGCGGTGAGG AAAGGAGGGA GCTTTGAAGG
TCGGGGGAGG GCGGAGGAGA TGTCTGAGGT GTCCGTTATG GCCGAGGTGG AGGAGACGGC GGCGGCGGCG CCGCTGGACC
TGCCGCCGGG GTTCAGGTTC CACCCCACCG ACGAGGAGAT CGTCTCGCAC TACCTCACCC CCAAGGCCCT CAACCACCGC
TTCTCCTCCG GCGTCATCGG CGACGTCGAC CTCAACAAGT GCGAGCCATG GCACCTCCCA GGTTTGTTCC TGAATTCTCT
CCTTTTTTTT CTCCCCTTGA TTCGTTCGTA CGATAAATCT TTGGGCTTAC GGATGAGTTT GCGTGGTTTG ATTTTTGGCA
GCCATGgcga agatggggga gaaggagtgg tacttcttct gccacaagga ccgcaagtac ccgaccggga cgaggacgaa
ccgggcgacg gagagcggct actggaaggc caccggcaag gacaaggaga tcttccgcgg gaggggcatc ctcgtcggca
tgaagaagac gctcgtcttc tacctcggcc gcgcgccccg tggcgagaag accggctggg tgatgcacga gttccgcctC
GAGGGCAAGC TCCCCAGCCA GCTCCCGCGC TCCGCCAAGG TCCGGCCGTT GCGTCCTTGC CTTGCCATGC TACTCTCGCT
TCTGCTTACT TCTCCAAAGT TTGAAAATTT CCTTCCTTTC TCGGTCGATG TGCTGATTCC TCATCTTTCC TCGACGCGTT
TGTTTGCGAA CAGGACCAGT GGGCGGTGTG CAAGGTGTTC AACAAGGAGT TGGCGCTGGC GGCGAAGAAC GGGCCAATGG
CGGTGACCGA AGCGACCGCC GACGACGCGG GGATCGAGCG GGTCGGCTCG TTCAGCTTCC TCAGCGACTT CATCGACCCC
GCCGAGCTGC CGCCGCTGAT GGACCCTTCC TTCGTCGCCG ACATCGACGG GGTGGACGAC GCCAAGGTGT CCGCGTCGAC
CTCCGGGCAG GCCGCGATCG CCGCCGGCTT CCATGTCGCG TCGCAGGTCA TGAGCTACCA GCAGGTCAAG ATGGAAGAGC
CGTTGCCGCT GCCGTACCTG CACCAGCAGC CGCCGCGGAT GCTGCACTCG GGTCAGTACT TCTCGCTCCC GGCGGTGCAC
CCCGGCGACC TGACGCCGTC GGCGATCCGG AGGTACTGCA AGGCGGAGCA GGTCTCGGGG CAGACGTCGG CGCTCAGCGC
CTCGCGCGAC ACCGGGCTCA GCACCGACCC CAACGCCGCC GGCTGCGCGG AGATCTCGTC GGCGCCGACG TCCCAGCCGT
TCCCGGAGTT CGACGACGGG ATTCTGGGCC TCGACGACTT CTGGAACTAA TCCACGCCTG AATGATCCGG AGCTAGCTCC
CTACCGACCT TGCGCTACAG GATTTTGCTT CAGGCTGGTT GATTAATTAC TTGATTTGAT TAATTAACTT GGTGTTTCAT
GCTTGGGTTA ATTAGTGGCA GTTTGTTGAT GCATCCTTCT CTTCCTCCTT CCGATCGAAG GCTTCTTCTC GGGATGGGTT
CGGATGATCA GATTATTTAT CATCCATCCA GACCTCCAGG GATTAGCTAG GACTCCTTGT TAATTAATCC TAGCTAGCTA
GGTTTCTTCA TGTCTTGATC TGATGTAAAT ACAATTACTA CTACTAAGTA CGGGGTATCC TGATTGTGTC TAGTAGCATG
ATGATTGATT ATACTACAAT CAATGGGGTG TAGATTAGGG GTGGATTGAT CATTTACGAA TTGATTAATT TGGCATTTGA
TGAGCCAGCT AGCTGCTAGC TTTATAAAGC TTTATACTAT GTACATGTAC CATTAATTGC TTGAGCTAGA CATCTCATCA
TATGTGAATT GATGCTTCGG TTTAGCCTT

Locus: Os03g0327100

Loading...

Locus: Os03g0327100

Loading...