Os03t0328000-01

Locus

Os03g0328000

Description

Dedicator of cytokinesis family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK059469 (DDBJ, Best hit)

Protein Evidence

NP_193367.7 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: guanyl-nucleotide exchange factor activity (GO:0005085)

Molecular Function: GTP binding (GO:0005525)

Molecular Function: GTPase binding (GO:0051020)

Functional domain (InterPro)

Dedicator of cytokinesis (IPR010703)

Full-length cDNA

001-028-D11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0328000-01)

RiceXPro (AK059469)

Others

KEGG (Os03t0328000-01)

Transcript

1117 bp

>Os03t0328000-01 Dedicator of cytokinesis family protein.
AGCGGTTTGGCAAACTCAACAAAAAGGAGTATGTGTTCAGAGAGCCAAGAGATGTTCGTC
TTGGTGACATAATGGAGAAGCTTAGTCATATCTATGAGGCTAAAATGGATGGCAATCACA
CCTTACACATCATTCCGGATTCGAGACAAGTCAACGCTGATGAGTTGCAACCTGGTGTCT
GCTATCTGCAGATAACTGCTGTTGATCCTGTAATGGAGGATGAGGACCTAGGGAGTAGAA
GGGAAAGGATTTTCTCTTTATCTACTGGTACTGTCCGGGCCCGTGTGTTCGACCGTTTTC
TTTTTGATACACCATTCACAAAGAATGGAAAAACACAAGGTGGCCTTGAAGATCAGTGGA
AGAGGCGCACAGTACTCCAGACAGAGGGTTCCTTTCCTGCTTTGGTGAATCGTCTGTTAG
TGATCAAATCAGAATCTCTAGAGTTTTCTCCTGTTGAGAATGCGATTGGAATGATCGAGA
CAAGGACAGCTGCCTTGCGAAATGAACTAGAAGAACCACGCAGTTCGGAAGGTGACCAAC
TCCCAAGACTCCAAAGCCTGCAGAGGATACTCCAAGGAAGTGTGGCTGTTCAGGTAAATA
GTGGTGTATTAAGTGTGTGCACTGCATTCTTATCTGGTGAGCCCGCAACTAGGCTCCGAT
CTCAAGAACTGCAGCAGCTCATCGCTGCATTGCTGGAATTCATGGCCGTCTGCAAGCGCG
CAATCCGTGTGCATTTTAGATTGATAGGGGAAGAAGACCAGGAATTCCACACTCAACTAG
TCAATGGCTTTCAGTCGCTCACAGCTGAGCTTTCACACTATATTCCTGCAATTCTTTCAG
AGCTATAACTGTATTCTAGCAAGCTGGCAAGTAGGTAGCATTTGAATGGTTCATTCTTTC
AGTTGGGGCTCCCCACCTTGTCCATAATTCCGTTAGTTTGGTTGTATAGTTCTGGAAAAC
TAACTAGGCTTTTCAATTCTGTTCTGTTTGCAATGCCGTGCCACGATTTTGGGGGTGTAA
AGCTTGTGTAATCCTTAGTGTGTTGTATCTCTATTACCTTGTTTATGCGGTTTGTAGACT
AATAGCAAGCTATATAGCAGTAACTATTCGAGTGGAC

CDS

846 bp

>Os03t0328000-01 Dedicator of cytokinesis family protein.
CGGTTTGGCAAACTCAACAAAAAGGAGTATGTGTTCAGAGAGCCAAGAGATGTTCGTCTT
GGTGACATAATGGAGAAGCTTAGTCATATCTATGAGGCTAAAATGGATGGCAATCACACC
TTACACATCATTCCGGATTCGAGACAAGTCAACGCTGATGAGTTGCAACCTGGTGTCTGC
TATCTGCAGATAACTGCTGTTGATCCTGTAATGGAGGATGAGGACCTAGGGAGTAGAAGG
GAAAGGATTTTCTCTTTATCTACTGGTACTGTCCGGGCCCGTGTGTTCGACCGTTTTCTT
TTTGATACACCATTCACAAAGAATGGAAAAACACAAGGTGGCCTTGAAGATCAGTGGAAG
AGGCGCACAGTACTCCAGACAGAGGGTTCCTTTCCTGCTTTGGTGAATCGTCTGTTAGTG
ATCAAATCAGAATCTCTAGAGTTTTCTCCTGTTGAGAATGCGATTGGAATGATCGAGACA
AGGACAGCTGCCTTGCGAAATGAACTAGAAGAACCACGCAGTTCGGAAGGTGACCAACTC
CCAAGACTCCAAAGCCTGCAGAGGATACTCCAAGGAAGTGTGGCTGTTCAGGTAAATAGT
GGTGTATTAAGTGTGTGCACTGCATTCTTATCTGGTGAGCCCGCAACTAGGCTCCGATCT
CAAGAACTGCAGCAGCTCATCGCTGCATTGCTGGAATTCATGGCCGTCTGCAAGCGCGCA
ATCCGTGTGCATTTTAGATTGATAGGGGAAGAAGACCAGGAATTCCACACTCAACTAGTC
AATGGCTTTCAGTCGCTCACAGCTGAGCTTTCACACTATATTCCTGCAATTCTTTCAGAG
CTATAA

Protein

282 aa

>Os03t0328000-01 Dedicator of cytokinesis family protein.
RFGKLNKKEYVFREPRDVRLGDIMEKLSHIYEAKMDGNHTLHIIPDSRQVNADELQPGVC
YLQITAVDPVMEDEDLGSRRERIFSLSTGTVRARVFDRFLFDTPFTKNGKTQGGLEDQWK
RRTVLQTEGSFPALVNRLLVIKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQL
PRLQSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRA
IRVHFRLIGEEDQEFHTQLVNGFQSLTAELSHYIPAILSEL*

5'UTR

chr03:12006546..12006547 (+ strand) : 2 bp

CDS

chr03:12006548..12007138 (+ strand) : 591 bp

chr03:12007257..12007511 (+ strand) : 255 bp

3'UTR

chr03:12007512..12007780 (+ strand) : 269 bp

FASTA

>Os03t0328000-01 class=Sequence position=chr03:12006546..12007780 (+ strand)
AGCGGTTTGG CAAACTCAAC AAAAAGGAGT ATGTGTTCAG AGAGCCAAGA GATGTTCGTC TTGGTGACAT AATGGAGAAG
CTTAGTCATA TCTATGAGGC TAAAATGGAT GGCAATCACA CCTTACACAT CATTCCGGAT TCGAGACAAG TCAACGCTGA
TGAGTTGCAA CCTGGTGTCT GCTATCTGCA GATAACTGCT GTTGATCCTG TAATGGAGGA TGAGGACCTA GGGAGTAGAA
GGGAAAGGAT TTTCTCTTTA TCTACTGGTA CTGTCCGGGC CCGTGTGTTC GACCGTTTTC TTTTTGATAC ACCATTCACA
AAGAATGGAA AAACACAAGG TGGCCTTGAA GATCAGTGGA AGAGGCGCAC AGTACTCCAG ACAGAGGGTT CCTTTCCTGC
TTTGGTGAAT CGTCTGTTAG TGATCAAATC AGAATCTCTA GAGTTTTCTC CTGTTGAGAA TGCGATTGGA ATGATCGAGA
CAAGGACAGC TGCCTTGCGA AATGAACTAG AAGAACCACG CAGTTCGGAA GGTGACCAAC TCCCAAGACT CCAAAGCCTG
CAGAGGATAC TCCAAGGAAG TGTGGCTGTT CAGGTAAGCT GTAAGCCTGT AACTCTTGTG CAGAATTTGA ACCATTTTTT
AAGAATGCCT TGAGTATATG CTCCTCTATT TTCTTTCTTT TGCTAACTTT TACAAAAACC TGACGATGCA GGTAAATAGT
GGTGTATTAA GTGTGTGCAC TGCATTCTTA TCTGGTGAGC CCGCAACTAG GCTCCGATCT CAAGAACTGC AGCAGCTCAT
CGCTGCATTG CTGGAATTCA TGGCCGTCTG CAAGCGCGCA ATCCGTGTGC ATTTTAGATT GATAGGGGAA GAAGACCAGG
AATTCCACAC TCAACTAGTC AATGGCTTTC AGTCGCTCAC AGCTGAGCTT TCACACTATA TTCCTGCAAT TCTTTCAGAG
CTATAACTGT ATTCTAGCAA GCTGGCAAGT AGGTAGCATT TGAATGGTTC ATTCTTTCAG TTGGGGCTCC CCACCTTGTC
CATAATTCCG TTAGTTTGGT TGTATAGTTC TGGAAAACTA ACTAGGCTTT TCAATTCTGT TCTGTTTGCA ATGCCGTGCC
ACGATTTTGG GGGTGTAAAG CTTGTGTAAT CCTTAGTGTG TTGTATCTCT ATTACCTTGT TTATGCGGTT TGTAGACTAA
TAGCAAGCTA TATAGCAGTA ACTATTCGAG TGGAC

Locus: Os03g0328000

Loading...

Locus: Os03g0328000

Loading...