Os03t0329900-01

Locus

Os03g0329900

Description

MYB-CC family protein, Pi-starvation signaling

RAP-DB Gene Symbol Synonym(s)

PHR1, OsPHR1

RAP-DB Gene Name Synonym(s)

PHOSPHATE STARVATION RESPONSE 1, PHOSPHATE RESPONSE1

CGSNL Gene Symbol

PHR1

CGSNL Gene Name

PHOSPHATE STARVATION RESPONSE 1

Oryzabase Gene Symbol Synonym(s)

OsPHR1

Oryzabase Gene Name Synonym(s)

PHOSPHATE RESPONSE1

Transcript Evidence

AK063486 (Genbank)

AK109510 (Genbank)

Protein Evidence

Q10LZ1 (UniProt)

Literature

PMID: 18263782

Note

Manual Curation

June 10, 2010

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Myb-like DNA-binding domain, SHAQKYF class (IPR006447)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Myb, DNA-binding (IPR014778)

Transcription regulator HTH, Myb-type, DNA-binding (IPR017930)

Full-length cDNA

001-116-C05 (Online Clone Ordering)

002-104-D09 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0329900-01)

Others

Oryzabase (9630)

Transcript

1989 bp

>Os03t0329900-01 MYB-CC family protein, Pi-starvation signaling
TCTCGATCAATCTCTCCTCCATTCCCGCATCCTCTCTCTCTCTCCCTCCTCACCCTCACC
TCATCGTCGCGACACCGAGGGGAAAAAAAAAAGCGATCGCCCCAATCAGATTCCCCCCCC
CCCCTCCTCCCCACTTCCCTCGTCGCCTCCGAAAAGCCAAGCCGCTCCCCGCCGCGCCGA
TCGCGCCGCCGCAGCCCCAGAGTGATGGACTAACATTTTGGGCGAGTTTGATCTGTAGAA
AGGCATTCAAACTATTTTATGGGAAAGAAGCAAATCTTATGCACTATTTGCAGAATTGCA
GTGAGGGAAGTTTGATCTGAGGCAGTTGCAAAACAAGTATTTCTGGAGAGATGTCATCCT
CCTTGCCTATTCTACCGAAATCTTTGAAAGATATCCCAAGATCCCATAATACCCAGAATA
TTCTGATGCCAGGGCAACTGCCAAATGATTCTATGCCTTTGCACCAGAGTGCAACTCAAT
CTTCTATTTCGCACCCAAGAGCCAGTGTTGTCAGATCATCATATTCAGCAATGTTAGGAT
ATGCTGCTAACCCAATTGATTCTGTGTCTAGCCATGAGGGGCATTTTATGGCTGCTCCCT
TTATTTCTCAGTCGTCGAATGCTGAAATGCTCCAGTATTTATGTAATAATAATACCCATG
GGGGACACACTGTGCCAACCTTTTTCCCAGCTCCTGCCTGTGGCGCGCCAGATTACATGG
ATACTATAACTGTCCCTGATAATCACACCCAGAGCGGCTCCTCTACTGTTACATCTGATG
CTGCTAAACAAAATGAATGGTGGGCAGATATAATGAATGATGACTGGAAAGATATTCTAG
ATGCAACAGCTACTGATTCTCAGTCAAAGTCCATGGCCCAACCTTCCAATTCTGCTGCAT
CACAGCCTGCTTTCAATCAGTCAACTTCATCCCATAGTGGCGATATTTGTCCTGTCACAA
GTCCTCCTCCCAACAACAGCAATGCCTCTGCAAGTAAACAACGGATGAGATGGACCCCGG
AATTGCATGAATCTTTTGTCCATGCTGTAAATAAGCTTGGTGGTAGTGAAAAAGCTACTC
CAAAAGGTGTGCTCAAGCTTATGAAAGTTGATGGTTTGACAATCTATCATGTTAAGAGTC
ATCTGCAGAAGTACCGCACAGCTCGCTACAAGCCAGACCTATCAGAAGGTAAAACACAAG
AAGGGAAAACTACCGATGAGTTGTCTTTGGACCTGAAAGCGAGCATGGATCTTACTGAAG
CACTGCGCCTTCAGATGGAAGTTCAGAAGCGCCTTCATGAACAACTCGAGATTCAGAGGA
AATTGCAGCTTCGAATTGAAGAACAAGGGAAATATCTGCAGAAGATGTTTGAAAAGCAAT
GTAAATCCAGCACACAGAGTGTGCAGGATCCATCGTCTGGAGATACAGCAACTCCATCTG
AGCCAAGCAATTCTGTAGACAAGGACAGTGAGGCTGCCTTGGACCCAAACAGAATAGGAG
ACAACCACCCTAAAAATTCTACCAATGTAGGTGCCAACCTGAAAACTGCAGCAACCGAGT
CCCCTGATTCCCCAGTAATTGCAACTGATGGATCGGAGCTCCCCCAAGAGAAGCGTCGTA
GAGTGCATGAATCTTGACAGTTAACTCATCTGAATGTAGAGTGCATTCAGATTATAGCTG
TTCTGCCCATGTACTTGGTAAAAGAAAAATGGTTCCATCTATATTGGCTGAAATTCTAGT
GCTGATCCAAGTCTATTGAGCTGAACTATTTAAAAGGAACATAAAAAAGCCTAATAGAGA
AGGGGAACTGTTTGGTGTCCGCTTGTATTATAATTCAGTAGCAATAACTCAAATTTATCT
CCGGTACTATGAAATAAGGAGAATTTGAGATCTAGCCATCTTCCTGGGTACAATTTTTAT
TTCAGGGAGTCAGTTGTAAAAGGCTACGGAACTCCCTCTTCCTCCTTGCAGCTCAGAAGA
TATTGAGCT

CDS

1287 bp

>Os03t0329900-01 MYB-CC family protein, Pi-starvation signaling
ATGTCATCCTCCTTGCCTATTCTACCGAAATCTTTGAAAGATATCCCAAGATCCCATAAT
ACCCAGAATATTCTGATGCCAGGGCAACTGCCAAATGATTCTATGCCTTTGCACCAGAGT
GCAACTCAATCTTCTATTTCGCACCCAAGAGCCAGTGTTGTCAGATCATCATATTCAGCA
ATGTTAGGATATGCTGCTAACCCAATTGATTCTGTGTCTAGCCATGAGGGGCATTTTATG
GCTGCTCCCTTTATTTCTCAGTCGTCGAATGCTGAAATGCTCCAGTATTTATGTAATAAT
AATACCCATGGGGGACACACTGTGCCAACCTTTTTCCCAGCTCCTGCCTGTGGCGCGCCA
GATTACATGGATACTATAACTGTCCCTGATAATCACACCCAGAGCGGCTCCTCTACTGTT
ACATCTGATGCTGCTAAACAAAATGAATGGTGGGCAGATATAATGAATGATGACTGGAAA
GATATTCTAGATGCAACAGCTACTGATTCTCAGTCAAAGTCCATGGCCCAACCTTCCAAT
TCTGCTGCATCACAGCCTGCTTTCAATCAGTCAACTTCATCCCATAGTGGCGATATTTGT
CCTGTCACAAGTCCTCCTCCCAACAACAGCAATGCCTCTGCAAGTAAACAACGGATGAGA
TGGACCCCGGAATTGCATGAATCTTTTGTCCATGCTGTAAATAAGCTTGGTGGTAGTGAA
AAAGCTACTCCAAAAGGTGTGCTCAAGCTTATGAAAGTTGATGGTTTGACAATCTATCAT
GTTAAGAGTCATCTGCAGAAGTACCGCACAGCTCGCTACAAGCCAGACCTATCAGAAGGT
AAAACACAAGAAGGGAAAACTACCGATGAGTTGTCTTTGGACCTGAAAGCGAGCATGGAT
CTTACTGAAGCACTGCGCCTTCAGATGGAAGTTCAGAAGCGCCTTCATGAACAACTCGAG
ATTCAGAGGAAATTGCAGCTTCGAATTGAAGAACAAGGGAAATATCTGCAGAAGATGTTT
GAAAAGCAATGTAAATCCAGCACACAGAGTGTGCAGGATCCATCGTCTGGAGATACAGCA
ACTCCATCTGAGCCAAGCAATTCTGTAGACAAGGACAGTGAGGCTGCCTTGGACCCAAAC
AGAATAGGAGACAACCACCCTAAAAATTCTACCAATGTAGGTGCCAACCTGAAAACTGCA
GCAACCGAGTCCCCTGATTCCCCAGTAATTGCAACTGATGGATCGGAGCTCCCCCAAGAG
AAGCGTCGTAGAGTGCATGAATCTTGA

Protein

429 aa

>Os03t0329900-01 MYB-CC family protein, Pi-starvation signaling
MSSSLPILPKSLKDIPRSHNTQNILMPGQLPNDSMPLHQSATQSSISHPRASVVRSSYSA
MLGYAANPIDSVSSHEGHFMAAPFISQSSNAEMLQYLCNNNTHGGHTVPTFFPAPACGAP
DYMDTITVPDNHTQSGSSTVTSDAAKQNEWWADIMNDDWKDILDATATDSQSKSMAQPSN
SAASQPAFNQSTSSHSGDICPVTSPPPNNSNASASKQRMRWTPELHESFVHAVNKLGGSE
KATPKGVLKLMKVDGLTIYHVKSHLQKYRTARYKPDLSEGKTQEGKTTDELSLDLKASMD
LTEALRLQMEVQKRLHEQLEIQRKLQLRIEEQGKYLQKMFEKQCKSSTQSVQDPSSGDTA
TPSEPSNSVDKDSEAALDPNRIGDNHPKNSTNVGANLKTAATESPDSPVIATDGSELPQE
KRRRVHES*

5'UTR

chr03:12126320..12126519 (+ strand) : 200 bp

chr03:12127564..12127713 (+ strand) : 150 bp

CDS

chr03:12127714..12128232 (+ strand) : 519 bp

chr03:12128850..12129051 (+ strand) : 202 bp

chr03:12129162..12129238 (+ strand) : 77 bp

chr03:12129327..12129366 (+ strand) : 40 bp

chr03:12129662..12129713 (+ strand) : 52 bp

chr03:12130191..12130260 (+ strand) : 70 bp

chr03:12130564..12130890 (+ strand) : 327 bp

3'UTR

chr03:12130891..12131242 (+ strand) : 352 bp

FASTA

>Os03t0329900-01 class=Sequence position=chr03:12126320..12131242 (+ strand)
TCTCGATCAA TCTCTCCTCC ATTCCCGCAT CCTCTCTCTC TCTCCCTCCT CACCCTCACC TCATCGTCGC GACACCGAGG
GGAAAAAAAA AAGCGATCGC CCCAATCAGA TTCCCCCCCC CCCCTCCTCC CCACTTCCCT CGTCGCCTCC GAAAAGCCAA
GCCGCTCCCC GCCGCGCCGA TCGCGCCGCC GCAGCCCCAG GTACGCCTCC TCTCCTCCCA TCCAATCTAG TCTCAGTCCA
CGCCGTCTCC ATCGATCGGC CCCGGTTGGA GCCTATGGAA CAGGAGCGGA CGAGCGCGTG CCCGCCGGGG AGAAGCTGGG
GGTAGGGGGT TTTTGGTTTA GGGTTTTGAT CGCGACATGT AGGGCGTGGG AGTTTGGTGG GGGGGAGCTG CTGTACCGCA
TGCTCGTGAG CGGACATGAT GGTGTTGGTA CAGGGAATTA TGGGGGGTTG ATTCTGTGAG GGTACGAACC GGGGGAGCTT
CACGGCAGAA TTATTAGGTA GTACTGTGGA GTGGTGTAGT GCTGTGATGG TTTGCTTCCG CCCTAGAAAC AGGATATTCT
AGTGCTTAAC CATTGGTTGC CGTACTGTGA GTTAATCGGT GCAGGCGTGA TAGAGAAGTA CACATTTCAT GTGTGTGTGT
GGCAAAAAAG TCTTAGGTAA AGAGTTATTT GCTTGATAGT AGGAAAAGAT GGTTGGGGCC AGTTGTGCCA CCACTATTCA
GGCCATCATT ATGGCGCCCT GTTCCACAGA GTTCTGCATG TGGGTTTGCT ATGCAGGAAA AATATCACTT TATAGCTTCA
AGAAAAATGT TAACTGAATA ATACCTTGGA ACTGGAATTT GCGGCATTTT TGCAATGTAG CTAGAAGTCG AACCTGCATC
GCAGGTATTA CATTTTAACT TTTCCGAAAG TATCCGGTTT GTAATGCTAA TAAATGAGGT TTATGCAATG TAATCTACCA
TTGGAGTGGT CAAAATATTG GGGGTGTAAA ATTTGTTGTT GTGCATCAGT GTACAAAAGG TTTACACCTA GATGTACATT
TCATGGCTTA GCCGTTTTTG TTTTCTGCTT GTGTCATCTG CTTGACACTA GCAACACTGC TGCTTATTCA TGATTAGTTC
CAGCATGCTT AAATGTGTGA AATATTATTT ACAGTCTATA TATGTTCCTT ACAATTATAC TATTATTTCC ATGACCTCAA
AATAAGCTCA CCCCTTTAAC TCTTCATTTC TTAATCATGT ACAGAGTGAT GGACTAACAT TTTGGGCGAG TTTGATCTGT
AGAAAGGCAT TCAAACTATT TTATGGGAAA GAAGCAAATC TTATGCACTA TTTGCAGAAT TGCAGTGAGG GAAGTTTGAT
CTGAGGCAGT TGCAAAACAA GTATTTCTGG AGAGATGTCA TCCTCCTTGC CTATTCTACC GAAATCTTTG AAAGATATCC
CAAGATCCCA TAATACCCAG AATATTCTGA TGCCAGGGCA ACTGCCAAAT GATTCTATGC CTTTGCACCA GAGTGCAACT
CAATCTTCTA TTTCGCACCC AAGAGCCAGT GTTGTCAGAT CATCATATTC AGCAATGTTA GGATATGCTG CTAACCCAAT
TGATTCTGTG TCTAGCCATG AGGGGCATTT TATGGCTGCT CCCTTTATTT CTCAGTCGTC GAATGCTGAA ATGCTCCAGT
ATTTATGTAA TAATAATACC CATGGGGGAC ACACTGTGCC AACCTTTTTC CCAGCTCCTG CCTGTGGCGC GCCAGATTAC
ATGGATACTA TAACTGTCCC TGATAATCAC ACCCAGAGCG GCTCCTCTAC TGTTACATCT GATGCTGCTA AACAAAATGA
ATGGTGGGCA GATATAATGA ATGATGACTG GAAAGATATT CTAGATGCAA CAGCTACTGA TTCTCAGTCA AAGGTATGTA
ACTGCAATAC CATAAAGAGT AAAGTTGTAT CCCTTTCTTG TGTTCTGGAA GTTTAGAAAT ACACCTATTT ATTTTAACAT
GTTGACGAAA GTTTCTAACA CTATAATCTA TTGAGAGTAT TTTGACATCA TCCTACTGGT AATAGTGGTA CCATCTGCCT
ACACTCTAAC CCGGTTACTA ATTTATATGA TCGTGATTAA TTTTAGAGAA ATTTTGCCTT TCCAGCAACA TACTTCTGTA
ACCATGGCGG TATTTTTTTC CCTTATTACA CAAGGGCATT TTGTTAGTTT ATCTATTCAT TTATTGAATG CTCGAAACTT
GTGTGAGATG TCATTTGTTA AAGTGATTAC CTGTACAAGA GCAATGATTA CTTGTTCCTT GGCTTGAAGA GATTGTGGCT
GTTGGTAGAT TAAATATTTG ATTCAATGTG TTAAAAATCC TGTAACGAAT TGTTCATGTT CTTGACATAG GCTGCTCCTG
GAAATTCTAA GCAATGTATA CTGCATCTTA CCTTTAACGC ATTTTTTTTG TCCCTGATGC TATAGATAGC GCTCCTTATG
TTTCTACCCT GGTCAGAATG CTAAATATTT ATGGATCTCT TTTGTTACAG TCCATGGCCC AACCTTCCAA TTCTGCTGCA
TCACAGCCTG CTTTCAATCA GTCAACTTCA TCCCATAGTG GCGATATTTG TCCTGTCACA AGTCCTCCTC CCAACAACAG
CAATGCCTCT GCAAGTAAAC AACGGATGAG ATGGACCCCG GAATTGCATG AATCTTTTGT CCATGCTGTA AATAAGCTTG
GTGGTAGTGA AAGTATGTCC TCCGTGTCGT AAATACCACT CAAGTGGTTT TCTCTTATAT ATACGAATCC TATTCTGGCA
TAGTCTAATA GTTTTTTTTT TTTAAAAAAA AAAAACCTTC AGAAGCTACT CCAAAAGGTG TGCTCAAGCT TATGAAAGTT
GATGGTTTGA CAATCTATCA TGTTAAGAGT CATCTGCAGG TTCTTTTTTT AATCTTTCTA AATGTCATAT TTGCTGAAAG
GAGACTTCAG TTTTGACTTT CTTTATCTGC ACTTATTTTT ACTGCAGAAG TACCGCACAG CTCGCTACAA GCCAGACCTA
TCAGAAGGTT TATATCAATT GGGTTCCTCT CTGACTTGCA TTTTATTTAT ACATATTCTT ACATACGGGA ACTCATTTTT
CATGGCAATA ACTTTTTTTT TAGAACTTCA TGGCAATAAC TTAAGTACAA TTTTCATGAT AATGGCAAGG GCTGTGAATT
TATTTGTAAA AGCATATTTT CATGATGAAA TATTAAATAC TTAGTGTAAG ATCCCTTGTT GCAAAATAGC ACGCATGCAA
CCATATTCTA GTTTATGTGA GTTGTTAAGA CAACTCTGAC CTTTTCTTAA CTCATCATGC AGGTAAAACA CAAGAAGGGA
AAACTACCGA TGAGTTGTCT TTGGACCTGA AAGCGTGAGT GGATATTATT ATTCCATCGT CTCTTCTCCT GTTTCATTGT
ACTTTTGGTA CACTTCACAT GGCGCTAACT AATAAGTAGG GTACTGTGTG GTTTACAAAT CAACATGCAT CAAAGTTCAG
ATCAAGAGCG TAGGCATGAC TGGATGGCAG ATTGCATTAC CGACTAAAGT AAATAATTGC CTTGAGAAAA AGTTGGTCGC
ACATATATAT TTGTGATTCA CTTGCTAGCA TGGTTTCAAA ATAAGAGTAG GGATTCGCCT ACTAGTATGG TTCAAATCTA
CAGTTTGCTC ATATAGCACA ATAGAAGATA TATCCATTTT ACTTCAAATT ATGTTTAGGA GTTACCATTA TGCATTATTG
AGGGAATGGT GGTATTTCAT GTTCATTTTT CTGTTGGATC AGTAAGTGCA CCATGTTCTT CCCAGTCACC AGTACTAGAT
ACCCTTGCAT TATGTTGTTT TGCTTATGTA GGAGCATGGA TCTTACTGAA GCACTGCGCC TTCAGATGGA AGTTCAGAAG
CGCCTTCATG AACAACTCGA GGTACTAATT CAAAAGCATG TGCACTGACT CTAAATTTGG TTGAAATAGG CTCATGCCAA
ATGGGCAAAT GGCACCTTAA TAAACTAAAA GAGGCATGCA ACAATTGCTA CCCTTTTGGG GATACAAATA TGAGACTCAG
AAATGTTCCT TTCGACACTA GTTTGTGGCA ATGAACAAAA TTGTGACTGC AGGAATGTGG CATGCTACAA TTGCACTGGT
CTTAATAATA TAGGGGTAGG ACATGCTCAT ATACTTCAAA TTAAATTCCC ATGACCTGAA GCACATTTGA TTGCTCTATT
GCAGATTCAG AGGAAATTGC AGCTTCGAAT TGAAGAACAA GGGAAATATC TGCAGAAGAT GTTTGAAAAG CAATGTAAAT
CCAGCACACA GAGTGTGCAG GATCCATCGT CTGGAGATAC AGCAACTCCA TCTGAGCCAA GCAATTCTGT AGACAAGGAC
AGTGAGGCTG CCTTGGACCC AAACAGAATA GGAGACAACC ACCCTAAAAA TTCTACCAAT GTAGGTGCCA ACCTGAAAAC
TGCAGCAACC GAGTCCCCTG ATTCCCCAGT AATTGCAACT GATGGATCGG AGCTCCCCCA AGAGAAGCGT CGTAGAGTGC
ATGAATCTTG ACAGTTAACT CATCTGAATG TAGAGTGCAT TCAGATTATA GCTGTTCTGC CCATGTACTT GGTAAAAGAA
AAATGGTTCC ATCTATATTG GCTGAAATTC TAGTGCTGAT CCAAGTCTAT TGAGCTGAAC TATTTAAAAG GAACATAAAA
AAGCCTAATA GAGAAGGGGA ACTGTTTGGT GTCCGCTTGT ATTATAATTC AGTAGCAATA ACTCAAATTT ATCTCCGGTA
CTATGAAATA AGGAGAATTT GAGATCTAGC CATCTTCCTG GGTACAATTT TTATTTCAGG GAGTCAGTTG TAAAAGGCTA
CGGAACTCCC TCTTCCTCCT TGCAGCTCAG AAGATATTGA GCT

Locus: Os03g0329900

Loading...

Locus: Os03g0329900

Loading...