Os03t0336200-01

Locus

Os03g0336200

Description

bZIP DNA-binding protein, Disease resistance, Vascular development

RAP-DB Gene Symbol Synonym(s)

RF2B, RF2b, OsbZIP30

RAP-DB Gene Name Synonym(s)

bZIP TRANSCRIPTION FACTOR RF2B, Transcription factor RF2b, bZIP transcription factor 30

CGSNL Gene Symbol

RF2B

CGSNL Gene Name

bZIP TRANSCRIPTION FACTOR RF2B

Oryzabase Gene Symbol Synonym(s)

RF2b, OsbZIP30

Oryzabase Gene Name Synonym(s)

Transcription factor RF2b, bZIP transcription factor 30

Transcript Evidence

AY466471 (Genbank)

AK059473 (Genbank)

Protein Evidence

Q6S4P4 (UniProt)

Literature

PMID: 14704272

PMID: 19104064

Note

Manual Curation

May 29, 2009

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Basic-leucine zipper domain (IPR004827)

bZIP transcription factor, bZIP-1 (IPR011616)

Full-length cDNA

001-028-E05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0336200-01)

RiceXPro (AK059473)

Others

Oryzabase (8246)

KEGG (Os03t0336200-01)

Transcript

1575 bp

>Os03t0336200-01 bZIP DNA-binding protein, Disease resistance, Vascular development
AACGCCATCCCAGCgcagcgcaggcacgcacggcaccggcggcggaggacgcggcaggag
cagcagccgcctcctccaatccccgagccgaacactcgctggcgggcgcgcgcgcgcgca
gccggggaaccgggggggagacagggtggtggtggtgaggcgggggcgagcgcaatgcag
gagccaaagcacaccgatccggcggccatgCGCGGGGCGCACCACCGCCGGGCCAGATCT
GAGGTCGCCTTCCGCCTGCCCGACGACCTCGACCTCGGCGGCGGCGGCGCGGGGGCGTTC
GACGAGATCGGCTCCGAGGACGACCTCTTCTCCACCTTCATGGACATCGAGAAGATCTCC
TCCGGCCCCGCCGCCGCGGGGGGCTCCGACCGGGACCGCGCCGCGGAGACGTCCTCGCCG
CCGCGCCCCAAGCACCGCCACAGCAGCTCCGTCGACGGCTCCGGGTTCTTCGCCGCCGCG
CGGAAGGACGCCGCCGCATCGCTGGCGGAGGTCATGGAGGCTAAGAAGGCCATGACCCCC
GAGCAGCTCTCCGAGCTCGCCGCCATCGACCCCAAGCGCGCCAAAAGAATTCTGGCGAAC
AGACAATCTGCAGCTCGGTCAAAAGAGAGAAAAGCTCGTTACATAACAGAACTTGAGCGG
AAGGTTCAAACTCTTCAGACTGAAGCCACTACTCTCTCAGCACAACTCACACTATTTCAG
AGAGACACAACTGGGCTTTCTGCAGAAAATGCAGAGCTCAAGATACGGTTGCAGGCCATG
GAACAACAGGCTCAACTGCGAGATGCTCTGAATGATGCACTAAAGCAGGAACTGGAGAGG
CTTAAGCTCGCTACTGGTGAGATGACAAATTCCAATGAGACATATAGCATGGGACTGCAA
CATGTCCCATACAACACCCCTTTCTTCCCTCTCGCCCAGCATAATGCAGCCCGCCAGAAC
GGTGGAACCCAGTTGCCACCACAATTCCAACCACCCCGTCCTAATGTGCCCAATCACATG
CTATCCCATCCAAACGGTTTGCAAGATATCATGCAGCAAGACCCTCTTGGCCGGCTTCAG
GGTTTGGACATCAGCAAAGGGCCTCTAGTTGTGAAATCAGAGAGCAGCTCGATCTCTGCA
AGTGAAAGCAGCAGCACCTTCTAACCAGGCCTACCCACCGAGCCCACAGTTCCATTAGAT
TCGTTTGTTCATAGCCTGACATCCTCGCGCTGCTCCCTGTTCTGTAAGCTTATTATTTAT
TCAATTCGTTCGATTTAGTTGAAATTGTTCGTAATTGCAGTGGCTGATCTATTCCCTTCT
GTGGACATGATTCCTGTACCCCTCACATCCATTTGTTTTGGGTTCATCTCCTGTGTGCTG
TGTTTGGGATTATCAGGGCACCAGGACTGGCTTTCTCCGAGAATACTGTGTTCTTTGTGG
TCGTGTGGACTTGTTCACCATGGATTCAATTCAACCTTTTGAAAAGATGCATGTATTCTC
TGATTTTTTTTTCTCAGTCATGTACATGTCACTGTTATGCTAGTTTGATTGATGTGTACT
GTGGAATTTGTGGAT

CDS

990 bp

>Os03t0336200-01 bZIP DNA-binding protein, Disease resistance, Vascular development
atgcaggagccaaagcacaccgatccggcggccatgCGCGGGGCGCACCACCGCCGGGCC
AGATCTGAGGTCGCCTTCCGCCTGCCCGACGACCTCGACCTCGGCGGCGGCGGCGCGGGG
GCGTTCGACGAGATCGGCTCCGAGGACGACCTCTTCTCCACCTTCATGGACATCGAGAAG
ATCTCCTCCGGCCCCGCCGCCGCGGGGGGCTCCGACCGGGACCGCGCCGCGGAGACGTCC
TCGCCGCCGCGCCCCAAGCACCGCCACAGCAGCTCCGTCGACGGCTCCGGGTTCTTCGCC
GCCGCGCGGAAGGACGCCGCCGCATCGCTGGCGGAGGTCATGGAGGCTAAGAAGGCCATG
ACCCCCGAGCAGCTCTCCGAGCTCGCCGCCATCGACCCCAAGCGCGCCAAAAGAATTCTG
GCGAACAGACAATCTGCAGCTCGGTCAAAAGAGAGAAAAGCTCGTTACATAACAGAACTT
GAGCGGAAGGTTCAAACTCTTCAGACTGAAGCCACTACTCTCTCAGCACAACTCACACTA
TTTCAGAGAGACACAACTGGGCTTTCTGCAGAAAATGCAGAGCTCAAGATACGGTTGCAG
GCCATGGAACAACAGGCTCAACTGCGAGATGCTCTGAATGATGCACTAAAGCAGGAACTG
GAGAGGCTTAAGCTCGCTACTGGTGAGATGACAAATTCCAATGAGACATATAGCATGGGA
CTGCAACATGTCCCATACAACACCCCTTTCTTCCCTCTCGCCCAGCATAATGCAGCCCGC
CAGAACGGTGGAACCCAGTTGCCACCACAATTCCAACCACCCCGTCCTAATGTGCCCAAT
CACATGCTATCCCATCCAAACGGTTTGCAAGATATCATGCAGCAAGACCCTCTTGGCCGG
CTTCAGGGTTTGGACATCAGCAAAGGGCCTCTAGTTGTGAAATCAGAGAGCAGCTCGATC
TCTGCAAGTGAAAGCAGCAGCACCTTCTAA

Protein

330 aa

>Os03t0336200-01 bZIP DNA-binding protein, Disease resistance, Vascular development
MQEPKHTDPAAMRGAHHRRARSEVAFRLPDDLDLGGGGAGAFDEIGSEDDLFSTFMDIEK
ISSGPAAAGGSDRDRAAETSSPPRPKHRHSSSVDGSGFFAAARKDAAASLAEVMEAKKAM
TPEQLSELAAIDPKRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTL
FQRDTTGLSAENAELKIRLQAMEQQAQLRDALNDALKQELERLKLATGEMTNSNETYSMG
LQHVPYNTPFFPLAQHNAARQNGGTQLPPQFQPPRPNVPNHMLSHPNGLQDIMQQDPLGR
LQGLDISKGPLVVKSESSSISASESSSTF*

5'UTR

chr03:12452080..12452253 (+ strand) : 174 bp

CDS

chr03:12452254..12452666 (+ strand) : 413 bp

chr03:12454325..12454457 (+ strand) : 133 bp

chr03:12455001..12455085 (+ strand) : 85 bp

chr03:12455441..12455799 (+ strand) : 359 bp

3'UTR

chr03:12455800..12456210 (+ strand) : 411 bp

FASTA

>Os03t0336200-01 class=Sequence position=chr03:12452080..12456210 (+ strand)
AACGCCATCC CAGCgcagcg caggcacgca cggcaccggc ggcggaggac gcggcaggag cagcagccgc ctcctccaat
ccccgagccg aacactcgct ggcgggcgcg cgcgcgcgca gccggggaac cgggggggag acagggtggt ggtggtgagg
cgggggcgag cgcaatgcag gagccaaagc acaccgatcc ggcggccatg CGCGGGGCGC ACCACCGCCG GGCCAGATCT
GAGGTCGCCT TCCGCCTGCC CGACGACCTC GACCTCGGCG GCGGCGGCGC GGGGGCGTTC GACGAGATCG GCTCCGAGGA
CGACCTCTTC TCCACCTTCA TGGACATCGA GAAGATCTCC TCCGGCCCCG CCGCCGCGGG GGGCTCCGAC CGGGACCGCG
CCGCGGAGAC GTCCTCGCCG CCGCGCCCCA AGCACCGCCA CAGCAGCTCC GTCGACGGCT CCGGGTTCTT CGCCGCCGCG
CGGAAGGACG CCGCCGCATC GCTGGCGGAG GTCATGGAGG CTAAGAAGGC CATGACCCCC GAGCAGCTCT CCGAGCTCGC
CGCCATCGAC CCCAAGCGCG CCAAAAGGTG CAAAGCCTCC CCGATCTCCC GCTCTCCATC CATCCGCTTG CTCTCGCGAA
TCCGACGTTG TCGTTGATGC TTAGATTAGA AAGGTGCCCG TCACACGCCA TAGATTAACA GATTACCTGT TTCGTTTCTC
CAAGGTAGCA GGGAATCATA CCAGACGAGG TACCTAGGAC AATTATGCAT GCATGCATCT TTCTGAAAAA TGCCTGGAGG
TTAGAGAAAA AGATGTGCAT TTGCGTCTTG TTTGTTTCTT TGCGTACTGT GTGGATTATT GGATAGATGG CGCTTGGTGG
TTGGTTGGCA GATCAGGAGT TAAGGTTATA AGTGCTAGTT ATCGAGCACT CGGTTGGTGG GATTGTTATG GATAAGTGTT
TGCTGCTGTG AGGTGGCGGC TTGGCGCATG CTTTTGTTGG CTTTTTTTTG CTGGGATTGT GAAAGGGGGT GGGTCAATAG
AGTAGGTGTA ATCGTTAGTT ACTTTTTAGT TGTGCATATG CGCTGGTTTT AATTCGATAT TAGTTACTGT CTAAGATGCT
AGATACTGTT TGGATGTCTG ATTAGATTGT TTTTTGTTTC TCTTTGCTTA GCTCTGGTAC CTAAGAAATG TGATGAACAA
ATGTTGCATC TCTAGTTAAA CTATGAAAAT GTAGCACAAT GATATGCGAT TAGTGACATG TTATTAAACC GGATTGTCTG
GATTGATTGT GAAAGGCAGT GGGACTGTGG GAGCAACAAC CAAAGGATAG ACATCCAATC GAATAAGAGA AAGCAACAGT
CTCAGTTTTG GAATTATTCT TTGAGGTCGT GTGTAGGCGT GTAGCCAATC AAATTAGAGA AAATACCATC ACCTTCTGGA
GTAGCTATTT AGGGGCTGCA AATACTTAAT AGTCAAAATT TTCTATATCT TAAAGCAATC AACCAATATA AAACTGTGAG
GGCAGTACTT CATTTCTTCA ACACATTGAA GATGTGCATT GATGCCTTCT GCAATGTAGG TCTGTCAACT TAGATGTTCT
AATTATCAGC ATGGTTGTGA TCTCACCAGT ACTAAACCAT GGTATACTTT CCACCTCAAT AAACTATTGC TATTCAGTTT
AACCAGATAG TATATCTAAA CTTATTTTTT TACAGTTAAC GTCTGATGCG TTAAAATTGC ATTGCCTCCC TTTGTTTTCT
CCCTAATTGT ATGCAGTAAA CAGTTTGTGT GAAACATCAA CCAAAAAAGA TCGCTTTACA CATGCCAGTT GGTTGACTTG
TCTGTAATTC TGCACATGCT TCCGATTTTG TTTTGTTTTC TAAACAATAT ACAAATGCTT CCCCAGTTCA TCTTTAATTT
AATAAGGTTA TCCGGGCAAT GAATATTTCT TCTTTTCTGT TCTGATATAT ACAAAAATAC TGAACATACC ATTATTTAAC
AAAATTTGAC TACACTTGTG TTTGATGTTG ATAAATAACA CTCCTATTTC TTTCTTGAAA TCTATGGTGG GATTTATCCC
TAATTCATGA TTTCTTTTAA ATTTGTAAAT ATTGTTTGTA ATGTGGAAAG TGGATTGAAG ATGAACACCC TCAATCGCTG
GCAAATTATC ATTATGTTCC TGAAATATTT TTAAACCAGG CAATTTGTAA TATTTTGTTA ACCTCTTGAG TTTGTTCTCT
TACAGAATTC TGGCGAACAG ACAATCTGCA GCTCGGTCAA AAGAGAGAAA AGCTCGTTAC ATAACAGAAC TTGAGCGGAA
GGTTCAAACT CTTCAGACTG AAGCCACTAC TCTCTCAGCA CAACTCACAC TATTTCAGGT GCCTTTCCAT CTATCTTTTG
CCTCATGGTT TAAATCATGA GTTTCTGGAA ACAGTAATCC TGTACTAGTG AAACACTGTT TTTCCTTGGC AATCTTAGTA
AACAAACTGG CTGTCGGCTG TTCCTCCATC CCCAATAGTT ACCACTTACC ACACAGCAAA CAAACTGTAG CTTCTTTGCT
AGATGCAAGA ATCCCATACA AGACGAGAAC CAAGTTGCGG CTTCCTTGTG GATTGCATCT AGCTTGATAG TTTTTCATGT
ACCATTGGAC AACTTGTATG TTGTATGCAT GACTTCTGCA CATGCTATGA TCATTATAAA TATCCATTGG ATTATTTTAT
ATGGCTATGT GAACACCTTG AAGAGCTGAA TGCTGATGGA GTGCATGTGA GAATAAAGAA TAAATCTATT CGTTGACTTT
TGACTATCTT GTTATAGGTT ATGCTATTTT GTTGTGCTGT TGACTTCTGA AAGAGCATAA AACCTTTCAA TTTATGGCTG
TGCTAAACTA CTGGCTCTTA AAACATTTCT TTTACTTTCA GAGAGACACA ACTGGGCTTT CTGCAGAAAA TGCAGAGCTC
AAGATACGGT TGCAGGCCAT GGAACAACAG GCTCAACTGC GAGATGGTGA GCATTTTCCT TAACTGGATA ACTATAGTTA
CTTAACATTT GTTGTTTTTC ATCAACAATA ACTAGTGGTA AAAGTATAAA ACTGATCATT ATATTGGAAA TGATAGCATC
AAAGTTCATT TATCCTTTCC TGATAGACAC ACCCTTTTCA TTTTACAATT CAGTCTAGAG CTATCCTAGC TATATACGTT
CTATTTGTGA CATCTTAAAT TTTGTGCCAA AAGCTAGAAT GATTTTTAAT ACGGAGACCC GTGTAATTAT ATTGGATATG
TAGAAGTGAT AGCTGGAGTA TGAATTGCAA CTGTGAGCGT ACCTTTCTGG TTCTAACAAA AAGTGTGATA TAATTTTTCA
GCTCTGAATG ATGCACTAAA GCAGGAACTG GAGAGGCTTA AGCTCGCTAC TGGTGAGATG ACAAATTCCA ATGAGACATA
TAGCATGGGA CTGCAACATG TCCCATACAA CACCCCTTTC TTCCCTCTCG CCCAGCATAA TGCAGCCCGC CAGAACGGTG
GAACCCAGTT GCCACCACAA TTCCAACCAC CCCGTCCTAA TGTGCCCAAT CACATGCTAT CCCATCCAAA CGGTTTGCAA
GATATCATGC AGCAAGACCC TCTTGGCCGG CTTCAGGGTT TGGACATCAG CAAAGGGCCT CTAGTTGTGA AATCAGAGAG
CAGCTCGATC TCTGCAAGTG AAAGCAGCAG CACCTTCTAA CCAGGCCTAC CCACCGAGCC CACAGTTCCA TTAGATTCGT
TTGTTCATAG CCTGACATCC TCGCGCTGCT CCCTGTTCTG TAAGCTTATT ATTTATTCAA TTCGTTCGAT TTAGTTGAAA
TTGTTCGTAA TTGCAGTGGC TGATCTATTC CCTTCTGTGG ACATGATTCC TGTACCCCTC ACATCCATTT GTTTTGGGTT
CATCTCCTGT GTGCTGTGTT TGGGATTATC AGGGCACCAG GACTGGCTTT CTCCGAGAAT ACTGTGTTCT TTGTGGTCGT
GTGGACTTGT TCACCATGGA TTCAATTCAA CCTTTTGAAA AGATGCATGT ATTCTCTGAT TTTTTTTTCT CAGTCATGTA
CATGTCACTG TTATGCTAGT TTGATTGATG TGTACTGTGG AATTTGTGGA T

Locus: Os03g0336200

Loading...

Locus: Os03g0336200

Loading...