Os03t0336200-02

Locus

Os03g0336200

Description

Transcription factor RF2b.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RF2B

CGSNL Gene Name

bZIP TRANSCRIPTION FACTOR RF2B

Oryzabase Gene Symbol Synonym(s)

RF2b, OsbZIP30

Oryzabase Gene Name Synonym(s)

Transcription factor RF2b, bZIP transcription factor 30

Transcript Evidence

AK070466 (DDBJ, Best hit)

Protein Evidence

Q6S4P4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Basic-leucine zipper (bZIP) transcription factor (IPR004827)

bZIP transcription factor, bZIP-1 (IPR011616)

Full-length cDNA

J023052D02 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0336200-02)

RiceXPro (AK070466)

Others

Oryzabase (8246)

KEGG (Os03t0336200-02)

Transcript

1610 bp

>Os03t0336200-02 Transcription factor RF2b.
gagccgaacactcgctggcgggcgcgcgcgcgcgcagccggggaaccgggggggagacag
ggtggtggtggtgaggcgggggcgagcgcaatgcaggagccaaagcacaccgatccggcg
gccatgCGCGGGGCGCACCACCGCCGGGCCAGATCTGAGGTCGCCTTCCGCCTGCCCGAC
GACCTCGACCTCGGCGGCGGCGGCGCGGGGGCGTTCGACGAGATCGGCTCCGAGGACGAC
CTCTTCTCCACCTTCATGGACATCGAGAAGATCTCCTCCGGCCCCGCCGCCGCGGGGGGC
TCCGACCGGGACCGCGCCGCGGAGACGTCCTCGCCGCCGCGCCCCAAGCACCGCCACAGC
AGCTCCGTCGACGGCTCCGGGTTCTTCGCCGCCGCGCGGAAGGACGCCGCCGCATCGCTG
GCGGAGGTCATGGAGGCTAAGAAGGCCATGACCCCCGAGCAGCTCTCCGAGCTCGCCGCC
ATCGACCCCAAGCGCGCCAAAAGAATTCTGGCGAACAGACAATCTGCAGCTCGGTCAAAA
GAGAGAAAAGCTCGTTACATAACAGAACTTGAGCGGAAGGTTCAAACTCTTCAGACTGAA
GCCACTACTCTCTCAGCACAACTCACACTATTTCAGAGAGACACAACTGGGCTTTCTGCA
GAAAATGCAGAGCTCAAGATACGGTTGCAGGCCATGGAACAACAGGCTCAACTGCGAGAT
GCTCTGAATGATGCACTAAAGCAGGAACTGGAGAGGCTTAAGCTCGCTACTGGTGAGATG
ACAAATTCCAATGAGACATATAGCATGGGACTGCAACATGTCCCATACAACACCCCTTTC
TTCCCTCTCGCCCAGCATAATGCAGCCCGCCAGAACGGTGGAACCCAGTTGCCACCACAA
TTCCAACCACCCCGTCCTAATGTGCCCAATCACATGCTATCCCATCCAAACGGTTTGCAA
GATATCATGCAGCAAGACCCTCTTGGCCGGCTTCAGGGTTTGGACATCAGCAAAGGGCCT
CTAGTTGTGAAATCAGAGAGCAGCTCGATCTCTGCAAGTGAAAGCAGCAGCACCTTCTAA
CCAGGCCTACCCACCGAGCCCACAGTTCCATTAGATTCGTTTGTTCATAGCCTGACATCC
TCGCGCTGCTCCCTGTTCTGTAAGCTTATTATTTATTCAATTCGTTCGATTTAGTTGAAA
TTGTTCGTAATTGCAGTGGCTGATCTATTCCCTTCTGTGGACATGATTCCTGTACCCCTC
ACATCCATTTGTTTTGGGTTCATCTCCTGTGTGCTGTGTTTGGGATTATCAGGGCACCAG
GACTGGCTTTCTCCGAGAATACTGTGTTCTTTGTGGTCGTGTGGACTTGTTCACCATGGA
TTCAATTCAACCTTTTGAAAAGATGCATGTATTCTCTGATTTTTTTTTCTCAGTCATGTA
CATGTCACTGTTATGCTAGTTTGATTGATGTGTACTGTGGAATTTGTGGATAACAAAAGG
AGTTAAGATTGGGATTGCTGTGGAACCATCTGTATCGTATATTCGTATGTGACTAATGTT
GGGAAATTGTTCTATTCTTGTTCACCATATGCATGTGGGGTAACTTTTCC

CDS

990 bp

>Os03t0336200-02 Transcription factor RF2b.
atgcaggagccaaagcacaccgatccggcggccatgCGCGGGGCGCACCACCGCCGGGCC
AGATCTGAGGTCGCCTTCCGCCTGCCCGACGACCTCGACCTCGGCGGCGGCGGCGCGGGG
GCGTTCGACGAGATCGGCTCCGAGGACGACCTCTTCTCCACCTTCATGGACATCGAGAAG
ATCTCCTCCGGCCCCGCCGCCGCGGGGGGCTCCGACCGGGACCGCGCCGCGGAGACGTCC
TCGCCGCCGCGCCCCAAGCACCGCCACAGCAGCTCCGTCGACGGCTCCGGGTTCTTCGCC
GCCGCGCGGAAGGACGCCGCCGCATCGCTGGCGGAGGTCATGGAGGCTAAGAAGGCCATG
ACCCCCGAGCAGCTCTCCGAGCTCGCCGCCATCGACCCCAAGCGCGCCAAAAGAATTCTG
GCGAACAGACAATCTGCAGCTCGGTCAAAAGAGAGAAAAGCTCGTTACATAACAGAACTT
GAGCGGAAGGTTCAAACTCTTCAGACTGAAGCCACTACTCTCTCAGCACAACTCACACTA
TTTCAGAGAGACACAACTGGGCTTTCTGCAGAAAATGCAGAGCTCAAGATACGGTTGCAG
GCCATGGAACAACAGGCTCAACTGCGAGATGCTCTGAATGATGCACTAAAGCAGGAACTG
GAGAGGCTTAAGCTCGCTACTGGTGAGATGACAAATTCCAATGAGACATATAGCATGGGA
CTGCAACATGTCCCATACAACACCCCTTTCTTCCCTCTCGCCCAGCATAATGCAGCCCGC
CAGAACGGTGGAACCCAGTTGCCACCACAATTCCAACCACCCCGTCCTAATGTGCCCAAT
CACATGCTATCCCATCCAAACGGTTTGCAAGATATCATGCAGCAAGACCCTCTTGGCCGG
CTTCAGGGTTTGGACATCAGCAAAGGGCCTCTAGTTGTGAAATCAGAGAGCAGCTCGATC
TCTGCAAGTGAAAGCAGCAGCACCTTCTAA

Protein

330 aa

>Os03t0336200-02 Transcription factor RF2b.
MQEPKHTDPAAMRGAHHRRARSEVAFRLPDDLDLGGGGAGAFDEIGSEDDLFSTFMDIEK
ISSGPAAAGGSDRDRAAETSSPPRPKHRHSSSVDGSGFFAAARKDAAASLAEVMEAKKAM
TPEQLSELAAIDPKRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTL
FQRDTTGLSAENAELKIRLQAMEQQAQLRDALNDALKQELERLKLATGEMTNSNETYSMG
LQHVPYNTPFFPLAQHNAARQNGGTQLPPQFQPPRPNVPNHMLSHPNGLQDIMQQDPLGR
LQGLDISKGPLVVKSESSSISASESSSTF*

5'UTR

chr03:12452164..12452253 (+ strand) : 90 bp

CDS

chr03:12452254..12452666 (+ strand) : 413 bp

chr03:12454325..12454457 (+ strand) : 133 bp

chr03:12455001..12455085 (+ strand) : 85 bp

chr03:12455441..12455799 (+ strand) : 359 bp

3'UTR

chr03:12455800..12456329 (+ strand) : 530 bp

FASTA

>Os03t0336200-02 class=Sequence position=chr03:12452164..12456329 (+ strand)
gagccgaaca ctcgctggcg ggcgcgcgcg cgcgcagccg gggaaccggg ggggagacag ggtggtggtg gtgaggcggg
ggcgagcgca atgcaggagc caaagcacac cgatccggcg gccatgCGCG GGGCGCACCA CCGCCGGGCC AGATCTGAGG
TCGCCTTCCG CCTGCCCGAC GACCTCGACC TCGGCGGCGG CGGCGCGGGG GCGTTCGACG AGATCGGCTC CGAGGACGAC
CTCTTCTCCA CCTTCATGGA CATCGAGAAG ATCTCCTCCG GCCCCGCCGC CGCGGGGGGC TCCGACCGGG ACCGCGCCGC
GGAGACGTCC TCGCCGCCGC GCCCCAAGCA CCGCCACAGC AGCTCCGTCG ACGGCTCCGG GTTCTTCGCC GCCGCGCGGA
AGGACGCCGC CGCATCGCTG GCGGAGGTCA TGGAGGCTAA GAAGGCCATG ACCCCCGAGC AGCTCTCCGA GCTCGCCGCC
ATCGACCCCA AGCGCGCCAA AAGGTGCAAA GCCTCCCCGA TCTCCCGCTC TCCATCCATC CGCTTGCTCT CGCGAATCCG
ACGTTGTCGT TGATGCTTAG ATTAGAAAGG TGCCCGTCAC ACGCCATAGA TTAACAGATT ACCTGTTTCG TTTCTCCAAG
GTAGCAGGGA ATCATACCAG ACGAGGTACC TAGGACAATT ATGCATGCAT GCATCTTTCT GAAAAATGCC TGGAGGTTAG
AGAAAAAGAT GTGCATTTGC GTCTTGTTTG TTTCTTTGCG TACTGTGTGG ATTATTGGAT AGATGGCGCT TGGTGGTTGG
TTGGCAGATC AGGAGTTAAG GTTATAAGTG CTAGTTATCG AGCACTCGGT TGGTGGGATT GTTATGGATA AGTGTTTGCT
GCTGTGAGGT GGCGGCTTGG CGCATGCTTT TGTTGGCTTT TTTTTGCTGG GATTGTGAAA GGGGGTGGGT CAATAGAGTA
GGTGTAATCG TTAGTTACTT TTTAGTTGTG CATATGCGCT GGTTTTAATT CGATATTAGT TACTGTCTAA GATGCTAGAT
ACTGTTTGGA TGTCTGATTA GATTGTTTTT TGTTTCTCTT TGCTTAGCTC TGGTACCTAA GAAATGTGAT GAACAAATGT
TGCATCTCTA GTTAAACTAT GAAAATGTAG CACAATGATA TGCGATTAGT GACATGTTAT TAAACCGGAT TGTCTGGATT
GATTGTGAAA GGCAGTGGGA CTGTGGGAGC AACAACCAAA GGATAGACAT CCAATCGAAT AAGAGAAAGC AACAGTCTCA
GTTTTGGAAT TATTCTTTGA GGTCGTGTGT AGGCGTGTAG CCAATCAAAT TAGAGAAAAT ACCATCACCT TCTGGAGTAG
CTATTTAGGG GCTGCAAATA CTTAATAGTC AAAATTTTCT ATATCTTAAA GCAATCAACC AATATAAAAC TGTGAGGGCA
GTACTTCATT TCTTCAACAC ATTGAAGATG TGCATTGATG CCTTCTGCAA TGTAGGTCTG TCAACTTAGA TGTTCTAATT
ATCAGCATGG TTGTGATCTC ACCAGTACTA AACCATGGTA TACTTTCCAC CTCAATAAAC TATTGCTATT CAGTTTAACC
AGATAGTATA TCTAAACTTA TTTTTTTACA GTTAACGTCT GATGCGTTAA AATTGCATTG CCTCCCTTTG TTTTCTCCCT
AATTGTATGC AGTAAACAGT TTGTGTGAAA CATCAACCAA AAAAGATCGC TTTACACATG CCAGTTGGTT GACTTGTCTG
TAATTCTGCA CATGCTTCCG ATTTTGTTTT GTTTTCTAAA CAATATACAA ATGCTTCCCC AGTTCATCTT TAATTTAATA
AGGTTATCCG GGCAATGAAT ATTTCTTCTT TTCTGTTCTG ATATATACAA AAATACTGAA CATACCATTA TTTAACAAAA
TTTGACTACA CTTGTGTTTG ATGTTGATAA ATAACACTCC TATTTCTTTC TTGAAATCTA TGGTGGGATT TATCCCTAAT
TCATGATTTC TTTTAAATTT GTAAATATTG TTTGTAATGT GGAAAGTGGA TTGAAGATGA ACACCCTCAA TCGCTGGCAA
ATTATCATTA TGTTCCTGAA ATATTTTTAA ACCAGGCAAT TTGTAATATT TTGTTAACCT CTTGAGTTTG TTCTCTTACA
GAATTCTGGC GAACAGACAA TCTGCAGCTC GGTCAAAAGA GAGAAAAGCT CGTTACATAA CAGAACTTGA GCGGAAGGTT
CAAACTCTTC AGACTGAAGC CACTACTCTC TCAGCACAAC TCACACTATT TCAGGTGCCT TTCCATCTAT CTTTTGCCTC
ATGGTTTAAA TCATGAGTTT CTGGAAACAG TAATCCTGTA CTAGTGAAAC ACTGTTTTTC CTTGGCAATC TTAGTAAACA
AACTGGCTGT CGGCTGTTCC TCCATCCCCA ATAGTTACCA CTTACCACAC AGCAAACAAA CTGTAGCTTC TTTGCTAGAT
GCAAGAATCC CATACAAGAC GAGAACCAAG TTGCGGCTTC CTTGTGGATT GCATCTAGCT TGATAGTTTT TCATGTACCA
TTGGACAACT TGTATGTTGT ATGCATGACT TCTGCACATG CTATGATCAT TATAAATATC CATTGGATTA TTTTATATGG
CTATGTGAAC ACCTTGAAGA GCTGAATGCT GATGGAGTGC ATGTGAGAAT AAAGAATAAA TCTATTCGTT GACTTTTGAC
TATCTTGTTA TAGGTTATGC TATTTTGTTG TGCTGTTGAC TTCTGAAAGA GCATAAAACC TTTCAATTTA TGGCTGTGCT
AAACTACTGG CTCTTAAAAC ATTTCTTTTA CTTTCAGAGA GACACAACTG GGCTTTCTGC AGAAAATGCA GAGCTCAAGA
TACGGTTGCA GGCCATGGAA CAACAGGCTC AACTGCGAGA TGGTGAGCAT TTTCCTTAAC TGGATAACTA TAGTTACTTA
ACATTTGTTG TTTTTCATCA ACAATAACTA GTGGTAAAAG TATAAAACTG ATCATTATAT TGGAAATGAT AGCATCAAAG
TTCATTTATC CTTTCCTGAT AGACACACCC TTTTCATTTT ACAATTCAGT CTAGAGCTAT CCTAGCTATA TACGTTCTAT
TTGTGACATC TTAAATTTTG TGCCAAAAGC TAGAATGATT TTTAATACGG AGACCCGTGT AATTATATTG GATATGTAGA
AGTGATAGCT GGAGTATGAA TTGCAACTGT GAGCGTACCT TTCTGGTTCT AACAAAAAGT GTGATATAAT TTTTCAGCTC
TGAATGATGC ACTAAAGCAG GAACTGGAGA GGCTTAAGCT CGCTACTGGT GAGATGACAA ATTCCAATGA GACATATAGC
ATGGGACTGC AACATGTCCC ATACAACACC CCTTTCTTCC CTCTCGCCCA GCATAATGCA GCCCGCCAGA ACGGTGGAAC
CCAGTTGCCA CCACAATTCC AACCACCCCG TCCTAATGTG CCCAATCACA TGCTATCCCA TCCAAACGGT TTGCAAGATA
TCATGCAGCA AGACCCTCTT GGCCGGCTTC AGGGTTTGGA CATCAGCAAA GGGCCTCTAG TTGTGAAATC AGAGAGCAGC
TCGATCTCTG CAAGTGAAAG CAGCAGCACC TTCTAACCAG GCCTACCCAC CGAGCCCACA GTTCCATTAG ATTCGTTTGT
TCATAGCCTG ACATCCTCGC GCTGCTCCCT GTTCTGTAAG CTTATTATTT ATTCAATTCG TTCGATTTAG TTGAAATTGT
TCGTAATTGC AGTGGCTGAT CTATTCCCTT CTGTGGACAT GATTCCTGTA CCCCTCACAT CCATTTGTTT TGGGTTCATC
TCCTGTGTGC TGTGTTTGGG ATTATCAGGG CACCAGGACT GGCTTTCTCC GAGAATACTG TGTTCTTTGT GGTCGTGTGG
ACTTGTTCAC CATGGATTCA ATTCAACCTT TTGAAAAGAT GCATGTATTC TCTGATTTTT TTTTCTCAGT CATGTACATG
TCACTGTTAT GCTAGTTTGA TTGATGTGTA CTGTGGAATT TGTGGATAAC AAAAGGAGTT AAGATTGGGA TTGCTGTGGA
ACCATCTGTA TCGTATATTC GTATGTGACT AATGTTGGGA AATTGTTCTA TTCTTGTTCA CCATATGCAT GTGGGGTAAC
TTTTCC

Locus: Os03g0336200

Loading...

Locus: Os03g0336200

Loading...