Os03t0344300-01

Locus

Os03g0344300

Description

SUMO protease, Panicle architecture and fertility

RAP-DB Gene Symbol Synonym(s)

OsFUG1, OsFUG1.1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

FUG1

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFUG1

Oryzabase Gene Name Synonym(s)

SUMO protease protein

Transcript Evidence

AK073314

Protein Evidence

Q10LL2

Literature

PMID: 30541427

Note

Manual Curation

March 25, 2021

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: cysteine-type peptidase activity (GO:0008234)

Functional domain (InterPro)

Papain-like cysteine peptidase superfamily (IPR038765)

Ulp1 protease family, C-terminal catalytic domain (IPR003653)

Full-length cDNA

J033024M21 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0344300-01)

RiceXPro (AK073314)

Others

Oryzabase (20942)

KEGG (Os03t0344300-01 (EC:3.4.22.68))

Transcript

1619 bp

>Os03t0344300-01 SUMO protease, Panicle architecture and fertility
GGGATTACAGTTAAACCAGTCTCCTCGTCTTCTCTCCTCCCCTCCCGCTTGGAGCTTTCC
GCTGCTCAAACCCCCGCCGCGCCAACCTAGGGCATGCTCCCAACCCCCATGGCCCTAGCC
CTAGCCCTAGCCCTATCCCCCTCCTCCTCCTCGCCATGACCGCCCTCGCCTCCCCCTTCC
TCCTCCCCCACCGCCGCCGGAAGCGCCCCCTCGACGATTCCCACTTCCACGGCCCGCAGC
GCCACCGCCGCCGCCGCCTCTGCCTCTGCCCGGCGGCCTTCCCCTCCCCGCCGATCCCGC
CCGAGGCGGCGTCGTCCCCCGCGTTCGACATGGGGGGCTTCCTCTCCTTCCTCCGGGGTA
AACCTAGGCACGACGATGCCGGCCTCGGGGTGTACAGGGGCTGGGTCGACGTCCGGTCGC
GGGATCTCTCGGTGGCCACCGCCATGGAAGACGACGACGCGGGGTTTGGCCCCCGGTTGG
TGGTGAGGCGGAGGGTCGGGGACCCGAGGAAGGCCGCCCTGGAGGCCGCGGCGCCGCGTC
CGCGGGTGAAGAGGGAGCCGTACTACAAGGAGGCGCTCGAGAGGATGAGGAGCCACGACA
AGAGGCTGGGCGAGCTCGCTTCACTGGTGAATCTAGAAGAGGAGAAACTCGCCGAGCTGC
GGAAGGCGGCTGAGCCACCCAAGGAGGACCTGTCTGAACTCTTTACACCTCTAACTGCTG
AAGAGGAAAATGAAGTTCATAATTGTTTGTTTGGTAGGGGTTCAAGTACTGAAATCCTAG
CACTGCATGAGCCCTCCAACATTGAAGTTAGCAGAGAGAAGTTCCGGTGCTTGAGACTGA
CTGCCTGGTTAAATGATGAGGTCATTAATTTGTACCTTGAATTATTGAAGGAGAGAGAGG
CAAGAGAACCAAAAAGGTTTTTGAAATGCCATTTCTTTAATACATTTTTTTATAAGAAGC
TTGCTTGCGGAAAAAATGGCTATGACTACAAATCTGTTAAAAGATGGACTACCCGCAGGA
GGTTGGGTTATGAGCTTATTGAGTGTGATAAAATCTTTGTCCCTGTACATAAAGATGTCC
ATTGGTGCTTAGCAGTTATAAACATGAAAGAAAGGACATTCCAATACCTTGATTCTCTTG
GTTGTGTGGATCATCATGTACCAAGAGTGCTGGCTAGATATATTGCAGAGGAAGTGAAGG
ACAAGAGTAATAAAGAGATCGACACAAACACTTGGCACGAAGAGTTAGTTGATGATATTC
CTTTGCAGCAAAATGGGTGGGACTGTGGTATGTTTATGCTCAAGTACATTGATTTCCACA
GCAGAGGATTGAGCATGTCTTTTAGTCAGGAAAACATGGAATATTTCAGAAAGAGAACAG
TGATGGAAATCTTAAGATTAAGAGCTGACTAATCAAATATGGATCCTTTTCCTTTTGGTG
AACAGCTGATTAACTTAGGTTGATATTCGTAGACTAAATTGTCAATCGTGTATACATTGT
TGGAAGTTGCCGGCAAAGATAGGAAATATATTTTTCCAGTGAGAAGCTGGAGTTTTGTCA
GTATGTAAACCTGTATGTTGATAACACCAGATTTCTGTAAAGTTCCGTTGTTTTTGGTG

CDS

1257 bp

>Os03t0344300-01 SUMO protease, Panicle architecture and fertility
ATGACCGCCCTCGCCTCCCCCTTCCTCCTCCCCCACCGCCGCCGGAAGCGCCCCCTCGAC
GATTCCCACTTCCACGGCCCGCAGCGCCACCGCCGCCGCCGCCTCTGCCTCTGCCCGGCG
GCCTTCCCCTCCCCGCCGATCCCGCCCGAGGCGGCGTCGTCCCCCGCGTTCGACATGGGG
GGCTTCCTCTCCTTCCTCCGGGGTAAACCTAGGCACGACGATGCCGGCCTCGGGGTGTAC
AGGGGCTGGGTCGACGTCCGGTCGCGGGATCTCTCGGTGGCCACCGCCATGGAAGACGAC
GACGCGGGGTTTGGCCCCCGGTTGGTGGTGAGGCGGAGGGTCGGGGACCCGAGGAAGGCC
GCCCTGGAGGCCGCGGCGCCGCGTCCGCGGGTGAAGAGGGAGCCGTACTACAAGGAGGCG
CTCGAGAGGATGAGGAGCCACGACAAGAGGCTGGGCGAGCTCGCTTCACTGGTGAATCTA
GAAGAGGAGAAACTCGCCGAGCTGCGGAAGGCGGCTGAGCCACCCAAGGAGGACCTGTCT
GAACTCTTTACACCTCTAACTGCTGAAGAGGAAAATGAAGTTCATAATTGTTTGTTTGGT
AGGGGTTCAAGTACTGAAATCCTAGCACTGCATGAGCCCTCCAACATTGAAGTTAGCAGA
GAGAAGTTCCGGTGCTTGAGACTGACTGCCTGGTTAAATGATGAGGTCATTAATTTGTAC
CTTGAATTATTGAAGGAGAGAGAGGCAAGAGAACCAAAAAGGTTTTTGAAATGCCATTTC
TTTAATACATTTTTTTATAAGAAGCTTGCTTGCGGAAAAAATGGCTATGACTACAAATCT
GTTAAAAGATGGACTACCCGCAGGAGGTTGGGTTATGAGCTTATTGAGTGTGATAAAATC
TTTGTCCCTGTACATAAAGATGTCCATTGGTGCTTAGCAGTTATAAACATGAAAGAAAGG
ACATTCCAATACCTTGATTCTCTTGGTTGTGTGGATCATCATGTACCAAGAGTGCTGGCT
AGATATATTGCAGAGGAAGTGAAGGACAAGAGTAATAAAGAGATCGACACAAACACTTGG
CACGAAGAGTTAGTTGATGATATTCCTTTGCAGCAAAATGGGTGGGACTGTGGTATGTTT
ATGCTCAAGTACATTGATTTCCACAGCAGAGGATTGAGCATGTCTTTTAGTCAGGAAAAC
ATGGAATATTTCAGAAAGAGAACAGTGATGGAAATCTTAAGATTAAGAGCTGACTAA

Protein

419 aa

>Os03t0344300-01 SUMO protease, Panicle architecture and fertility
MTALASPFLLPHRRRKRPLDDSHFHGPQRHRRRRLCLCPAAFPSPPIPPEAASSPAFDMG
GFLSFLRGKPRHDDAGLGVYRGWVDVRSRDLSVATAMEDDDAGFGPRLVVRRRVGDPRKA
ALEAAAPRPRVKREPYYKEALERMRSHDKRLGELASLVNLEEEKLAELRKAAEPPKEDLS
ELFTPLTAEEENEVHNCLFGRGSSTEILALHEPSNIEVSREKFRCLRLTAWLNDEVINLY
LELLKEREAREPKRFLKCHFFNTFFYKKLACGKNGYDYKSVKRWTTRRRLGYELIECDKI
FVPVHKDVHWCLAVINMKERTFQYLDSLGCVDHHVPRVLARYIAEEVKDKSNKEIDTNTW
HEELVDDIPLQQNGWDCGMFMLKYIDFHSRGLSMSFSQENMEYFRKRTVMEILRLRAD*

5'UTR

chr03:12828124..12828278 (- strand) : 155 bp

CDS

chr03:12827593..12828123 (- strand) : 531 bp

chr03:12827030..12827109 (- strand) : 80 bp

chr03:12826850..12826943 (- strand) : 94 bp

chr03:12826589..12826687 (- strand) : 99 bp

chr03:12825367..12825459 (- strand) : 93 bp

chr03:12825150..12825269 (- strand) : 120 bp

chr03:12824787..12824890 (- strand) : 104 bp

chr03:12824448..12824520 (- strand) : 73 bp

chr03:12824189..12824251 (- strand) : 63 bp

3'UTR

chr03:12823982..12824188 (- strand) : 207 bp

FASTA

>Os03t0344300-01 class=Sequence position=chr03:12823982..12828278 (- strand)
GGGATTACAG TTAAACCAGT CTCCTCGTCT TCTCTCCTCC CCTCCCGCTT GGAGCTTTCC GCTGCTCAAA CCCCCGCCGC
GCCAACCTAG GGCATGCTCC CAACCCCCAT GGCCCTAGCC CTAGCCCTAG CCCTATCCCC CTCCTCCTCC TCGCCATGAC
CGCCCTCGCC TCCCCCTTCC TCCTCCCCCA CCGCCGCCGG AAGCGCCCCC TCGACGATTC CCACTTCCAC GGCCCGCAGC
GCCACCGCCG CCGCCGCCTC TGCCTCTGCC CGGCGGCCTT CCCCTCCCCG CCGATCCCGC CCGAGGCGGC GTCGTCCCCC
GCGTTCGACA TGGGGGGCTT CCTCTCCTTC CTCCGGGGTA AACCTAGGCA CGACGATGCC GGCCTCGGGG TGTACAGGGG
CTGGGTCGAC GTCCGGTCGC GGGATCTCTC GGTGGCCACC GCCATGGAAG ACGACGACGC GGGGTTTGGC CCCCGGTTGG
TGGTGAGGCG GAGGGTCGGG GACCCGAGGA AGGCCGCCCT GGAGGCCGCG GCGCCGCGTC CGCGGGTGAA GAGGGAGCCG
TACTACAAGG AGGCGCTCGA GAGGATGAGG AGCCACGACA AGAGGCTGGG CGAGCTCGCT TCACTGGTGA ATCTAGAAGA
GGAGAAACTC GCCGAGCTGC GGAAGGCGGC TGAGCCACCC AAGGAGGTAT CGATATCGTT ACGTTTACCA TTCCTTTGTT
TTTATGTTAT ATTATTTTCA TAGTTGGTGA ATGTGAAGAT CACAACTCAC TAGTGGTAAA GTGTGCGTAT TGCGTTGAAG
TGAATTAATG GAGGTTCATT GTAATGAGAG CTTCGGGGCA TAGCTACATA ATTGAGTTCT TGAACTTTTT CAAGTTTAAA
GTTTGGACAA TTTTAGGCTT CCTAGTATCG CTCGCCCTAA ATAGATGTTT TGAATTGTCA AAAAAAGAGA GAGAGGGGCA
AGCAAGGATG TCTTGACACA ATGTGGATTC TAGAGTCGAT TCTCCTTTTG AGTGCTTGCG AATTCACAAG ATATGCATTT
GAATGTAGAG TTTAATTGGG GGAAAGTATA TTCCTTTGTT GATTAACCTT TCTTAGTTGT TGCTCTATAT CAACCTTTTA
TGCTTTTGCT CACTGTCGGT TTCTGCATGT TGATCTTTCA CTACTCCAGG ACCTGTCTGA ACTCTTTACA CCTCTAACTG
CTGAAGAGGA AAATGAAGTT CATAATTGTT TGTTTGGTAG GGGTTCAAGG TACCTTTGAT GACCCTGCTG CATGTTGTTT
GTAGCTTCTA TGTTTGTTGC TATAACAATT GATCATCACT CTTTTGTCCT TACAGTACTG AAATCCTAGC ACTGCATGAG
CCCTCCAACA TTGAAGTTAG CAGAGAGAAG TTCCGGTGCT TGAGACTGAC TGCCTGGTTA AATGATGAGG TAACTATCTA
TCTTGAATAT ACTTATATAT GAAACAAACT CCACTAGTAT CTATGGTTTA CTTCCTTTTT TTAAAAAAAA GATTGATGGT
TTACATGGAC CGGCGATGAC CCTGCCCATA TTATCTTACG TAATGAGGGC ATGTATTCCT CTTACATGCA GGTCATTAAT
TTGTACCTTG AATTATTGAA GGAGAGAGAG GCAAGAGAAC CAAAAAGGTT TTTGAAATGC CATTTCTTTA ATACATTTTT
TTATAAGAAG GTTAGATCAT AAGCTTCTTT TGCTTTCACG TATTCTATCT TCGTATTCAT ATTAAATGTT CTTATCGTCT
CTGTACTTTA TAACTTTTTT TAGCATTTCT GGTGTATTAT TGGTTTATAA GGATTTGGTG CAATGAACTT ATGAGTGTTC
AAATATGATA TCACTGTAGG AACATTTATA TTATATTTCA GTTGTGTTAT TAATTTATGG ACATTTTTAG AGTTTTTCCC
TCAGGAGGTA TATAGGTAAT AACTGTCCAG ATATCTTCAT GGGTTTCTCA GGTTAACATC ATTACTGGCT TTGGAGCCTT
AATTGGACAC AAATACTCAA TTAGCTTGTG TTTATGGCAT ATTAACTAAT ATGCTATTCA TTTGGCTCAT TTAGGTATAT
ATTAATTCAT CCATAGAAAA TTATAGGgca tattatatat tgaaaagtca aactttatag attctgacca acaattactc
aaatcataaa tatatttggt gtatcagaat tatactgata gattcatatT TCTGAGAGCT TTTCATAAAA TGTTGGTTGC
GCAGATATTA CGAATGTAAT TTATGAGCAA TCAATGGTTA AGCTCTTTTC CTAAAGATTT TTTTTTTAAA ATATGATATG
CCCTATATTT ACTCTAGGAA CAGTCAATAG CAGCATATGT TTGACTTCAG TCATACGACA ACAGGATACA GTTCTAAACG
GAGGGCTTAG TTCTCCATTT GCTTTTTTGG TTTTCTTAAG TTTTGTTATC ACTTATTCGA GACATTTGTT GTGGAAATGG
TAGACAGTTT TATGTTTTCA GTTTATCCTT GCTTCATTGT TCATTGAAGA TTTCTAAAAT ATCACTCCAT TCCAAAGGAT
GATGTTTGGA GAAATGCCAC CCAAGTGTTA GCTTCGCAAA ATACCATTAC TTCTTCTCTT TGGGGGGCAG TATTGTGTTG
GCCTGTTTGG TTAGGGATGG GAAATTCTAG GAAGTTCTTC ATTTGCCTTC ATCCACTCAT TTGATATCCT TTTATTATGA
ATTTTACCAT TTCATTTTCA TTTGTGAATG CTGAATTGCT GATCACCAAG TAAATGCTAA TCTTCATTGA CTCCCTGAAT
TGTTGGTCGT TTGGTTCAGC TTGCTTGCGG AAAAAATGGC TATGACTACA AATCTGTTAA AAGATGGACT ACCCGCAGGA
GGTTGGGTTA TGAGCTTATT GAGTGTGATA AAGTAAAGTA TCTGTTGCAT TCTTAGTCCT TCTGTTGTCA CGGATGTTGG
AACATGCTTA TTTGTAATTA TAAACTTATC CTCAGAATTT ACTTTGCAGA TCTTTGTCCC TGTACATAAA GATGTCCATT
GGTGCTTAGC AGTTATAAAC ATGAAAGAAA GGACATTCCA ATACCTTGAT TCTCTTGGTT GTGTGGATCA TCATGTACCA
AGAGTGCTGG TAAACTTATA GCTGTAGAGA AAAAATACAA CTGGGGCACT CAAAAAGTAG TACCCCCTTC TATTGCTATT
TCCTGCATGG CATTTTATTT TTTTTAAAAA AAAGGTTGTT AAATGTGTTA TGCTCTAGGG GAATTTGCAT GTTCGTAGTT
ATTTCGGTGT TTCATTAATG TGTTGCTAAG CTTGTTTAAT CCATCAAATA CTTGCAGTTA CAGATTTGAG TGGGCTTACC
TGTATTTTAT TGTGCATGCC ACTCACAGGC TAGATATATT GCAGAGGAAG TGAAGGACAA GAGTAATAAA GAGATCGACA
CAAACACTTG GCACGAAGAG TTAGTTGATG ATATTCCTTT GCAGCAAAAT GGGTATGTAT TGCATGTGCT AATGATTATT
TCCTGCATAA ATTCAGTATT ATGGAACACA ATCACTTTCA ATAGCTTGAA CCATGATTTG TTAGGTATTA TCATGTGTTA
AACCTTCAGC GGTTTTCTGT ATGTTTTTTT AATCCATGTT TGGTTGGATG GCCATATGAA GAATTCATTT TGTAACATAA
GCATTGGCAC ATTCATGAAC ATGTTACGAT GGACAACAAT ATAGTTTTAG TTGACACAAG CATCGTATAT TTGAACAGGT
GGGACTGTGG TATGTTTATG CTCAAGTACA TTGATTTCCA CAGCAGAGGA TTGAGCATGT CTTTTAGTCA GGTGAGTTGG
ATTCATTTAA GAAATTTGAG CAGAATATCC TCTGCCTCTG GGCTAGTGCC TTAACAATTT GGACTTAGCA TGTGTTGTAG
ACTTCATTAT GTAAATTTCT CGTGTGAGTA CATAAGCTTG TTTCACAATT TCTCGAGGTG ATTTTACATA ATCATGCTTA
TCAGTGTGGT TTGTTTTGGA ACTGCAGGAA AACATGGAAT ATTTCAGAAA GAGAACAGTG ATGGAAATCT TAAGATTAAG
AGCTGACTAA TCAAATATGG ATCCTTTTCC TTTTGGTGAA CAGCTGATTA ACTTAGGTTG ATATTCGTAG ACTAAATTGT
CAATCGTGTA TACATTGTTG GAAGTTGCCG GCAAAGATAG GAAATATATT TTTCCAGTGA GAAGCTGGAG TTTTGTCAGT
ATGTAAACCT GTATGTTGAT AACACCAGAT TTCTGTAAAG TTCCGTTGTT TTTGGTG

Locus: Os03g0344300

Loading...

Locus: Os03g0344300

Loading...