Os03t0344300-02

Locus

Os03g0344300

Description

Similar to Ulp1 protease family, C-terminal catalytic domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

FUG1

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFUG1

Oryzabase Gene Name Synonym(s)

SUMO protease protein

Transcript Evidence

AK068651 (DDBJ, Best hit)

Protein Evidence

Q10LL2 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: cysteine-type peptidase activity (GO:0008234)

Functional domain (InterPro)

Peptidase C48, SUMO/Sentrin/Ubl1 (IPR003653)

Full-length cDNA

J013159A19 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0344300-02)

Others

Oryzabase (20942)

Transcript

2195 bp

>Os03t0344300-02 Similar to Ulp1 protease family, C-terminal catalytic domain containing protein, expressed.
CTGCTCAAACCCCCGCCGCGCCAACCTAGGGCATGCTCCCAACCCCCATGGCCCTAGCCC
TAGCCCTAGCCCTATCCCCCTCCTCCTCCTCGCCATGACCGCCCTCGCCTCCCCCTTCCT
CCTCCCCCACCGCCGCCGGAAGCGCCCCCTCGACGATTCCCACTTCCACGGCCCGCAGCG
CCACCGCCGCCGCCGCCTCTGCCTCTGCCCGGCGGCCTTCCCCTCCCCGCCGATCCCGCC
CGAGGCGGCGTCGTCCCCCGCGTTCGACATGGGGGGCTTCCTCTCCTTCCTCCGGGGTAA
ACCTAGGCACGACGATGCCGGCCTCGGGGTGTACAGGGGCTGGGTCGACGTCCGGTCGCG
GGATCTCTCGGTGGCCACCGCCATGGAAGACGACGACGCGGGGTTTGGCCCCCGGTTGGT
GGTGAGGCGGAGGGTCGGGGACCCGAGGAAGGCCGCCCTGGAGGCCGCGGCGCCGCGTCC
GCGGGTGAAGAGGGAGCCGTACTACAAGGAGGCGCTCGAGAGGATGAGGAGCCACGACAA
GAGGCTGGGCGAGCTCGCTTCACTGGTGAATCTAGAAGAGGAGAAACTCGCCGAGCTGCG
GAAGGCGGCTGAGCCACCCAAGGAGGACCTGTCTGAACTCTTTACACCTCTAACTGCTGA
AGAGGAAAATGAAGTTCATAATTGTTTGTTTGGTAGGGGTTCAAGTACTGAAATCCTAGC
ACTGCATGAGCCCTCCAACATTGAAGTTAGCAGAGAGAAGTTCCGGTGCTTGAGACTGAC
TGCCTGGTTAAATGATGAGGTCATTAATTTGTACCTTGAATTATTGAAGGAGAGAGAGGC
AAGAGAACCAAAAAGGTTTTTGAAATGCCATTTCTTTAATACATTTTTTTATAAGAAGGA
TGATGTTTGGAGAAATGCCACCCAAGTGTTAGCTTCGCAAAATACCATTACTTCTTCTCT
TTGGGGGGCAGTATTGTGTTGGCCTGTTTGGTTAGGGATGGGAAATTCTAGGAAGTTCTT
CATTTGCCTTCATCCACTCATTTGATATCCTTTTATTATGAATTTTACCATTTCATTTTC
ATTTGTGAATGCTGAATTGCTGATCACCAAGTAAATGCTAATCTTCATTGACTCCCTGAA
TTGTTGGTCGTTTGGTTCAGCTTGCTTGCGGAAAAAATGGCTATGACTACAAATCTGTTA
AAAGATGGACTACCCGCAGGAGGTTGGGTTATGAGCTTATTGAGTGTGATAAAATCTTTG
TCCCTGTACATAAAGATGTCCATTGGTGCTTAGCAGTTATAAACATGAAAGAAAGGACAT
TCCAATACCTTGATTCTCTTGGTTGTGTGGATCATCATGTACCAAGAGTGCTGGCTAGAT
ATATTGCAGAGGAAGTGAAGGACAAGAGTAATAAAGAGATCGACACAAACACTTGGCACG
AAGAGTTAGTTGATGATATTCCTTTGCAGCAAAATGGGTGGGACTGTGGTATGTTTATGC
TCAAGTACATTGATTTCCACAGCAGAGGATTGAGCATGTCTTTTAGTCAGGAAAACATGG
AATATTTCAGAAAGAGAACAGTGATGGAAATCTTAAGATTAAGAGCTGACTAATCAAATA
TGGATCCTTTTCCTTTTGGTGAACAGCTGATTAACTTAGGTTGATATTCGTAGACTAAAT
TGTCAATCGTGTATACATTGTTGGAAGTTGCCGGCAAAGATAGGAAATATATTTTTCCAG
TGAGAAGCTGGAGTTTTGTCAGTATGTAAACCTGTATGTTGATAACACCAGATTTCTGTA
AAGTTCCGTTGTTTTTGGTGATTCAGTTGGCAGAAAGAACAAGAGGGGGAAGAGAATCTT
TGCGCTCGGTTGAACAATCTGTATCTGAAGAGTTTAACTTTTAGGAGCCTAGCCGTAGTG
CTACTGATACTTACCATTTGCTGCTCATTTGATTGTTCTTGTAGTGCTTTGGTAGCTGGT
GGGGATTGGCATGCTCTGGTGCATGCCAGAAAAGAGGAAAGGTTGTACCCGGCATCCACA
AGTTAAACAAATGCGTATAATGGTTCTTCATTTGTAAACCATGTGTTTGTGTTGTCAAAT
TTACTCGGGACATCCGAAACGTAAAACATCATGTTTTGTGATTTGTTTAATGAAACCTTA
TGTTCTGGGGCAAAATGTTACTTAAAACCCCAGGT

CDS

951 bp

>Os03t0344300-02 Similar to Ulp1 protease family, C-terminal catalytic domain containing protein, expressed.
ATGACCGCCCTCGCCTCCCCCTTCCTCCTCCCCCACCGCCGCCGGAAGCGCCCCCTCGAC
GATTCCCACTTCCACGGCCCGCAGCGCCACCGCCGCCGCCGCCTCTGCCTCTGCCCGGCG
GCCTTCCCCTCCCCGCCGATCCCGCCCGAGGCGGCGTCGTCCCCCGCGTTCGACATGGGG
GGCTTCCTCTCCTTCCTCCGGGGTAAACCTAGGCACGACGATGCCGGCCTCGGGGTGTAC
AGGGGCTGGGTCGACGTCCGGTCGCGGGATCTCTCGGTGGCCACCGCCATGGAAGACGAC
GACGCGGGGTTTGGCCCCCGGTTGGTGGTGAGGCGGAGGGTCGGGGACCCGAGGAAGGCC
GCCCTGGAGGCCGCGGCGCCGCGTCCGCGGGTGAAGAGGGAGCCGTACTACAAGGAGGCG
CTCGAGAGGATGAGGAGCCACGACAAGAGGCTGGGCGAGCTCGCTTCACTGGTGAATCTA
GAAGAGGAGAAACTCGCCGAGCTGCGGAAGGCGGCTGAGCCACCCAAGGAGGACCTGTCT
GAACTCTTTACACCTCTAACTGCTGAAGAGGAAAATGAAGTTCATAATTGTTTGTTTGGT
AGGGGTTCAAGTACTGAAATCCTAGCACTGCATGAGCCCTCCAACATTGAAGTTAGCAGA
GAGAAGTTCCGGTGCTTGAGACTGACTGCCTGGTTAAATGATGAGGTCATTAATTTGTAC
CTTGAATTATTGAAGGAGAGAGAGGCAAGAGAACCAAAAAGGTTTTTGAAATGCCATTTC
TTTAATACATTTTTTTATAAGAAGGATGATGTTTGGAGAAATGCCACCCAAGTGTTAGCT
TCGCAAAATACCATTACTTCTTCTCTTTGGGGGGCAGTATTGTGTTGGCCTGTTTGGTTA
GGGATGGGAAATTCTAGGAAGTTCTTCATTTGCCTTCATCCACTCATTTGA

Protein

317 aa

>Os03t0344300-02 Similar to Ulp1 protease family, C-terminal catalytic domain containing protein, expressed.
MTALASPFLLPHRRRKRPLDDSHFHGPQRHRRRRLCLCPAAFPSPPIPPEAASSPAFDMG
GFLSFLRGKPRHDDAGLGVYRGWVDVRSRDLSVATAMEDDDAGFGPRLVVRRRVGDPRKA
ALEAAAPRPRVKREPYYKEALERMRSHDKRLGELASLVNLEEEKLAELRKAAEPPKEDLS
ELFTPLTAEEENEVHNCLFGRGSSTEILALHEPSNIEVSREKFRCLRLTAWLNDEVINLY
LELLKEREAREPKRFLKCHFFNTFFYKKDDVWRNATQVLASQNTITSSLWGAVLCWPVWL
GMGNSRKFFICLHPLI*

5'UTR

chr03:12828124..12828217 (- strand) : 94 bp

CDS

chr03:12827593..12828123 (- strand) : 531 bp

chr03:12827030..12827109 (- strand) : 80 bp

chr03:12826850..12826943 (- strand) : 94 bp

chr03:12826589..12826687 (- strand) : 99 bp

chr03:12825575..12825721 (- strand) : 147 bp

3'UTR

chr03:12825367..12825574 (- strand) : 208 bp

chr03:12825150..12825269 (- strand) : 120 bp

chr03:12824787..12824890 (- strand) : 104 bp

chr03:12824448..12824520 (- strand) : 73 bp

chr03:12823607..12824251 (- strand) : 645 bp

FASTA

>Os03t0344300-02 class=Sequence position=chr03:12823607..12828217 (- strand)
CTGCTCAAAC CCCCGCCGCG CCAACCTAGG GCATGCTCCC AACCCCCATG GCCCTAGCCC TAGCCCTAGC CCTATCCCCC
TCCTCCTCCT CGCCATGACC GCCCTCGCCT CCCCCTTCCT CCTCCCCCAC CGCCGCCGGA AGCGCCCCCT CGACGATTCC
CACTTCCACG GCCCGCAGCG CCACCGCCGC CGCCGCCTCT GCCTCTGCCC GGCGGCCTTC CCCTCCCCGC CGATCCCGCC
CGAGGCGGCG TCGTCCCCCG CGTTCGACAT GGGGGGCTTC CTCTCCTTCC TCCGGGGTAA ACCTAGGCAC GACGATGCCG
GCCTCGGGGT GTACAGGGGC TGGGTCGACG TCCGGTCGCG GGATCTCTCG GTGGCCACCG CCATGGAAGA CGACGACGCG
GGGTTTGGCC CCCGGTTGGT GGTGAGGCGG AGGGTCGGGG ACCCGAGGAA GGCCGCCCTG GAGGCCGCGG CGCCGCGTCC
GCGGGTGAAG AGGGAGCCGT ACTACAAGGA GGCGCTCGAG AGGATGAGGA GCCACGACAA GAGGCTGGGC GAGCTCGCTT
CACTGGTGAA TCTAGAAGAG GAGAAACTCG CCGAGCTGCG GAAGGCGGCT GAGCCACCCA AGGAGGTATC GATATCGTTA
CGTTTACCAT TCCTTTGTTT TTATGTTATA TTATTTTCAT AGTTGGTGAA TGTGAAGATC ACAACTCACT AGTGGTAAAG
TGTGCGTATT GCGTTGAAGT GAATTAATGG AGGTTCATTG TAATGAGAGC TTCGGGGCAT AGCTACATAA TTGAGTTCTT
GAACTTTTTC AAGTTTAAAG TTTGGACAAT TTTAGGCTTC CTAGTATCGC TCGCCCTAAA TAGATGTTTT GAATTGTCAA
AAAAAGAGAG AGAGGGGCAA GCAAGGATGT CTTGACACAA TGTGGATTCT AGAGTCGATT CTCCTTTTGA GTGCTTGCGA
ATTCACAAGA TATGCATTTG AATGTAGAGT TTAATTGGGG GAAAGTATAT TCCTTTGTTG ATTAACCTTT CTTAGTTGTT
GCTCTATATC AACCTTTTAT GCTTTTGCTC ACTGTCGGTT TCTGCATGTT GATCTTTCAC TACTCCAGGA CCTGTCTGAA
CTCTTTACAC CTCTAACTGC TGAAGAGGAA AATGAAGTTC ATAATTGTTT GTTTGGTAGG GGTTCAAGGT ACCTTTGATG
ACCCTGCTGC ATGTTGTTTG TAGCTTCTAT GTTTGTTGCT ATAACAATTG ATCATCACTC TTTTGTCCTT ACAGTACTGA
AATCCTAGCA CTGCATGAGC CCTCCAACAT TGAAGTTAGC AGAGAGAAGT TCCGGTGCTT GAGACTGACT GCCTGGTTAA
ATGATGAGGT AACTATCTAT CTTGAATATA CTTATATATG AAACAAACTC CACTAGTATC TATGGTTTAC TTCCTTTTTT
TAAAAAAAAG ATTGATGGTT TACATGGACC GGCGATGACC CTGCCCATAT TATCTTACGT AATGAGGGCA TGTATTCCTC
TTACATGCAG GTCATTAATT TGTACCTTGA ATTATTGAAG GAGAGAGAGG CAAGAGAACC AAAAAGGTTT TTGAAATGCC
ATTTCTTTAA TACATTTTTT TATAAGAAGG TTAGATCATA AGCTTCTTTT GCTTTCACGT ATTCTATCTT CGTATTCATA
TTAAATGTTC TTATCGTCTC TGTACTTTAT AACTTTTTTT AGCATTTCTG GTGTATTATT GGTTTATAAG GATTTGGTGC
AATGAACTTA TGAGTGTTCA AATATGATAT CACTGTAGGA ACATTTATAT TATATTTCAG TTGTGTTATT AATTTATGGA
CATTTTTAGA GTTTTTCCCT CAGGAGGTAT ATAGGTAATA ACTGTCCAGA TATCTTCATG GGTTTCTCAG GTTAACATCA
TTACTGGCTT TGGAGCCTTA ATTGGACACA AATACTCAAT TAGCTTGTGT TTATGGCATA TTAACTAATA TGCTATTCAT
TTGGCTCATT TAGGTATATA TTAATTCATC CATAGAAAAT TATAGGgcat attatatatt gaaaagtcaa actttataga
ttctgaccaa caattactca aatcataaat atatttggtg tatcagaatt atactgatag attcatatTT CTGAGAGCTT
TTCATAAAAT GTTGGTTGCG CAGATATTAC GAATGTAATT TATGAGCAAT CAATGGTTAA GCTCTTTTCC TAAAGATTTT
TTTTTTAAAA TATGATATGC CCTATATTTA CTCTAGGAAC AGTCAATAGC AGCATATGTT TGACTTCAGT CATACGACAA
CAGGATACAG TTCTAAACGG AGGGCTTAGT TCTCCATTTG CTTTTTTGGT TTTCTTAAGT TTTGTTATCA CTTATTCGAG
ACATTTGTTG TGGAAATGGT AGACAGTTTT ATGTTTTCAG TTTATCCTTG CTTCATTGTT CATTGAAGAT TTCTAAAATA
TCACTCCATT CCAAAGGATG ATGTTTGGAG AAATGCCACC CAAGTGTTAG CTTCGCAAAA TACCATTACT TCTTCTCTTT
GGGGGGCAGT ATTGTGTTGG CCTGTTTGGT TAGGGATGGG AAATTCTAGG AAGTTCTTCA TTTGCCTTCA TCCACTCATT
TGATATCCTT TTATTATGAA TTTTACCATT TCATTTTCAT TTGTGAATGC TGAATTGCTG ATCACCAAGT AAATGCTAAT
CTTCATTGAC TCCCTGAATT GTTGGTCGTT TGGTTCAGCT TGCTTGCGGA AAAAATGGCT ATGACTACAA ATCTGTTAAA
AGATGGACTA CCCGCAGGAG GTTGGGTTAT GAGCTTATTG AGTGTGATAA AGTAAAGTAT CTGTTGCATT CTTAGTCCTT
CTGTTGTCAC GGATGTTGGA ACATGCTTAT TTGTAATTAT AAACTTATCC TCAGAATTTA CTTTGCAGAT CTTTGTCCCT
GTACATAAAG ATGTCCATTG GTGCTTAGCA GTTATAAACA TGAAAGAAAG GACATTCCAA TACCTTGATT CTCTTGGTTG
TGTGGATCAT CATGTACCAA GAGTGCTGGT AAACTTATAG CTGTAGAGAA AAAATACAAC TGGGGCACTC AAAAAGTAGT
ACCCCCTTCT ATTGCTATTT CCTGCATGGC ATTTTATTTT TTTTAAAAAA AAGGTTGTTA AATGTGTTAT GCTCTAGGGG
AATTTGCATG TTCGTAGTTA TTTCGGTGTT TCATTAATGT GTTGCTAAGC TTGTTTAATC CATCAAATAC TTGCAGTTAC
AGATTTGAGT GGGCTTACCT GTATTTTATT GTGCATGCCA CTCACAGGCT AGATATATTG CAGAGGAAGT GAAGGACAAG
AGTAATAAAG AGATCGACAC AAACACTTGG CACGAAGAGT TAGTTGATGA TATTCCTTTG CAGCAAAATG GGTATGTATT
GCATGTGCTA ATGATTATTT CCTGCATAAA TTCAGTATTA TGGAACACAA TCACTTTCAA TAGCTTGAAC CATGATTTGT
TAGGTATTAT CATGTGTTAA ACCTTCAGCG GTTTTCTGTA TGTTTTTTTA ATCCATGTTT GGTTGGATGG CCATATGAAG
AATTCATTTT GTAACATAAG CATTGGCACA TTCATGAACA TGTTACGATG GACAACAATA TAGTTTTAGT TGACACAAGC
ATCGTATATT TGAACAGGTG GGACTGTGGT ATGTTTATGC TCAAGTACAT TGATTTCCAC AGCAGAGGAT TGAGCATGTC
TTTTAGTCAG GTGAGTTGGA TTCATTTAAG AAATTTGAGC AGAATATCCT CTGCCTCTGG GCTAGTGCCT TAACAATTTG
GACTTAGCAT GTGTTGTAGA CTTCATTATG TAAATTTCTC GTGTGAGTAC ATAAGCTTGT TTCACAATTT CTCGAGGTGA
TTTTACATAA TCATGCTTAT CAGTGTGGTT TGTTTTGGAA CTGCAGGAAA ACATGGAATA TTTCAGAAAG AGAACAGTGA
TGGAAATCTT AAGATTAAGA GCTGACTAAT CAAATATGGA TCCTTTTCCT TTTGGTGAAC AGCTGATTAA CTTAGGTTGA
TATTCGTAGA CTAAATTGTC AATCGTGTAT ACATTGTTGG AAGTTGCCGG CAAAGATAGG AAATATATTT TTCCAGTGAG
AAGCTGGAGT TTTGTCAGTA TGTAAACCTG TATGTTGATA ACACCAGATT TCTGTAAAGT TCCGTTGTTT TTGGTGATTC
AGTTGGCAGA AAGAACAAGA GGGGGAAGAG AATCTTTGCG CTCGGTTGAA CAATCTGTAT CTGAAGAGTT TAACTTTTAG
GAGCCTAGCC GTAGTGCTAC TGATACTTAC CATTTGCTGC TCATTTGATT GTTCTTGTAG TGCTTTGGTA GCTGGTGGGG
ATTGGCATGC TCTGGTGCAT GCCAGAAAAG AGGAAAGGTT GTACCCGGCA TCCACAAGTT AAACAAATGC GTATAATGGT
TCTTCATTTG TAAACCATGT GTTTGTGTTG TCAAATTTAC TCGGGACATC CGAAACGTAA AACATCATGT TTTGTGATTT
GTTTAATGAA ACCTTATGTT CTGGGGCAAA ATGTTACTTA AAACCCCAGG T

Locus: Os03g0344300

Loading...

Locus: Os03g0344300

Loading...