Os03t0344300-04

Locus

Os03g0344300

Description

Splicing variant of OsFUG1

RAP-DB Gene Symbol Synonym(s)

OsFUG1, OsFUG1.3

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

FUG1

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFUG1

Oryzabase Gene Name Synonym(s)

SUMO protease protein

Transcript Evidence

Inferred from literature

Protein Evidence

Q10LL0

Literature

PMID: 30541427

Note

Manual Curation

March 25, 2021

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: cysteine-type peptidase activity (GO:0008234)

Functional domain (InterPro)

Papain-like cysteine peptidase superfamily (IPR038765)

Ulp1 protease family, C-terminal catalytic domain (IPR003653)

Others

Oryzabase (20942)

Transcript

1534 bp

>Os03t0344300-04 Splicing variant of OsFUG1
GGGATTACAGTTAAACCAGTCTCCTCGTCTTCTCTCCTCCCCTCCCGCTTGGAGCTTTCC
GCTGCTCAAACCCCCGCCGCGCCAACCTAGGGCATGCTCCCAACCCCCATGGCCCTAGCC
CTAGCCCTAGCCCTATCCCCCTCCTCCTCCTCGCCATGACCGCCCTCGCCTCCCCCTTCC
TCCTCCCCCACCGCCGCCGGAAGCGCCCCCTCGACGATTCCCACTTCCACGGCCCGCAGC
GCCACCGCCGCCGCCGCCTCTGCCTCTGCCCGGCGGCCTTCCCCTCCCCGCCGATCCCGC
CCGAGGCGGCGTCGTCCCCCGCGTTCGACATGGGGGGCTTCCTCTCCTTCCTCCGGGGTA
AACCTAGGCACGACGATGCCGGCCTCGGGGTGTACAGGGGCTGGGTCGACGTCCGGTCGC
GGGATCTCTCGGTGGCCACCGCCATGGAAGACGACGACGCGGGGTTTGGCCCCCGGTTGG
TGGTGAGGCGGAGGGTCGGGGACCCGAGGAAGGCCGCCCTGGAGGCCGCGGCGCCGCGTC
CGCGGGTGAAGAGGGAGCCGTACTACAAGGAGGCGCTCGAGAGGATGAGGAGCCACGACA
AGAGGCTGGGCGAGCTCGCTTCACTGGTGAATCTAGAAGAGGAGAAACTCGCCGAGCTGC
GGAAGGCGGCTGAGCCACCCAAGGAGGACCTGTCTGAACTCTTTACACCTCTAACTGCTG
AAGAGGAAAATGAAGTTCATAATTGTTTGTTTGGTAGGGGTTCAAGTACTGAAATCCTAG
CACTGCATGAGCCCTCCAACATTGAAGTTAGCAGAGAGAAGTTCCGGTGCTTGAGACTGA
CTGCCTGGTTAAATGATGAGGTCATTAATTTGTACCTTGAATTATTGAAGGAGAGAGAGG
CAAGAGAACCAAAAAGGTTTTTGAAATGCCATTTCTTTAATACATTTTTTTATAAGAAGG
TTAGATCATAAGCTTCTTTTGCTTTCACGTATTCTATCTTCGTATTCATATTAAATGTTC
TTATCGTCTCTGTACTTTATAACTTTTTTTAGCATTTCTGGTGTATTATTGGTTTATAAG
GATTTGGTGCAATGAACTTATGAGTGTTCAAATATGATATCACTGTAGGAACATTTATAT
TATATTTCAGTTGTGTTATTAATTTATGGACATTTTTAGAGTTTTTCCCTCAGGAGGTAT
ATAGGTAATAACTGTCCAGATATCTTCATGGGTTTCTCAGGTTAACATCATTACTGGCTT
TGGAGCCTTAATTGGACACAAATACTCAATTAGCTTGTGTTTATGGCATATTAACTAATA
TGCTATTCATTTGGCTCATTTAGGTATATATTAATTCATCCATAGAAAATTATAGGgcat
attatatattgaaaagtcaaactttatagattctgaccaacaattactcaaatcataaat
atatttggtgtatcagaattatactgatagattcatatTTCTGAGAGCTTTTCATAAAAT
GTTGGTTGCGCAGATATTACGAATGTAATTTATG

CDS

816 bp

>Os03t0344300-04 Splicing variant of OsFUG1
ATGACCGCCCTCGCCTCCCCCTTCCTCCTCCCCCACCGCCGCCGGAAGCGCCCCCTCGAC
GATTCCCACTTCCACGGCCCGCAGCGCCACCGCCGCCGCCGCCTCTGCCTCTGCCCGGCG
GCCTTCCCCTCCCCGCCGATCCCGCCCGAGGCGGCGTCGTCCCCCGCGTTCGACATGGGG
GGCTTCCTCTCCTTCCTCCGGGGTAAACCTAGGCACGACGATGCCGGCCTCGGGGTGTAC
AGGGGCTGGGTCGACGTCCGGTCGCGGGATCTCTCGGTGGCCACCGCCATGGAAGACGAC
GACGCGGGGTTTGGCCCCCGGTTGGTGGTGAGGCGGAGGGTCGGGGACCCGAGGAAGGCC
GCCCTGGAGGCCGCGGCGCCGCGTCCGCGGGTGAAGAGGGAGCCGTACTACAAGGAGGCG
CTCGAGAGGATGAGGAGCCACGACAAGAGGCTGGGCGAGCTCGCTTCACTGGTGAATCTA
GAAGAGGAGAAACTCGCCGAGCTGCGGAAGGCGGCTGAGCCACCCAAGGAGGACCTGTCT
GAACTCTTTACACCTCTAACTGCTGAAGAGGAAAATGAAGTTCATAATTGTTTGTTTGGT
AGGGGTTCAAGTACTGAAATCCTAGCACTGCATGAGCCCTCCAACATTGAAGTTAGCAGA
GAGAAGTTCCGGTGCTTGAGACTGACTGCCTGGTTAAATGATGAGGTCATTAATTTGTAC
CTTGAATTATTGAAGGAGAGAGAGGCAAGAGAACCAAAAAGGTTTTTGAAATGCCATTTC
TTTAATACATTTTTTTATAAGAAGGTTAGATCATAA

Protein

272 aa

>Os03t0344300-04 Splicing variant of OsFUG1
MTALASPFLLPHRRRKRPLDDSHFHGPQRHRRRRLCLCPAAFPSPPIPPEAASSPAFDMG
GFLSFLRGKPRHDDAGLGVYRGWVDVRSRDLSVATAMEDDDAGFGPRLVVRRRVGDPRKA
ALEAAAPRPRVKREPYYKEALERMRSHDKRLGELASLVNLEEEKLAELRKAAEPPKEDLS
ELFTPLTAEEENEVHNCLFGRGSSTEILALHEPSNIEVSREKFRCLRLTAWLNDEVINLY
LELLKEREAREPKRFLKCHFFNTFFYKKVRS*

5'UTR

chr03:12828124..12828278 (- strand) : 155 bp

CDS

chr03:12827593..12828123 (- strand) : 531 bp

chr03:12827030..12827109 (- strand) : 80 bp

chr03:12826850..12826943 (- strand) : 94 bp

chr03:12826577..12826687 (- strand) : 111 bp

3'UTR

chr03:12826014..12826576 (- strand) : 563 bp

FASTA

>Os03t0344300-04 class=Sequence position=chr03:12826014..12828278 (- strand)
GGGATTACAG TTAAACCAGT CTCCTCGTCT TCTCTCCTCC CCTCCCGCTT GGAGCTTTCC GCTGCTCAAA CCCCCGCCGC
GCCAACCTAG GGCATGCTCC CAACCCCCAT GGCCCTAGCC CTAGCCCTAG CCCTATCCCC CTCCTCCTCC TCGCCATGAC
CGCCCTCGCC TCCCCCTTCC TCCTCCCCCA CCGCCGCCGG AAGCGCCCCC TCGACGATTC CCACTTCCAC GGCCCGCAGC
GCCACCGCCG CCGCCGCCTC TGCCTCTGCC CGGCGGCCTT CCCCTCCCCG CCGATCCCGC CCGAGGCGGC GTCGTCCCCC
GCGTTCGACA TGGGGGGCTT CCTCTCCTTC CTCCGGGGTA AACCTAGGCA CGACGATGCC GGCCTCGGGG TGTACAGGGG
CTGGGTCGAC GTCCGGTCGC GGGATCTCTC GGTGGCCACC GCCATGGAAG ACGACGACGC GGGGTTTGGC CCCCGGTTGG
TGGTGAGGCG GAGGGTCGGG GACCCGAGGA AGGCCGCCCT GGAGGCCGCG GCGCCGCGTC CGCGGGTGAA GAGGGAGCCG
TACTACAAGG AGGCGCTCGA GAGGATGAGG AGCCACGACA AGAGGCTGGG CGAGCTCGCT TCACTGGTGA ATCTAGAAGA
GGAGAAACTC GCCGAGCTGC GGAAGGCGGC TGAGCCACCC AAGGAGGTAT CGATATCGTT ACGTTTACCA TTCCTTTGTT
TTTATGTTAT ATTATTTTCA TAGTTGGTGA ATGTGAAGAT CACAACTCAC TAGTGGTAAA GTGTGCGTAT TGCGTTGAAG
TGAATTAATG GAGGTTCATT GTAATGAGAG CTTCGGGGCA TAGCTACATA ATTGAGTTCT TGAACTTTTT CAAGTTTAAA
GTTTGGACAA TTTTAGGCTT CCTAGTATCG CTCGCCCTAA ATAGATGTTT TGAATTGTCA AAAAAAGAGA GAGAGGGGCA
AGCAAGGATG TCTTGACACA ATGTGGATTC TAGAGTCGAT TCTCCTTTTG AGTGCTTGCG AATTCACAAG ATATGCATTT
GAATGTAGAG TTTAATTGGG GGAAAGTATA TTCCTTTGTT GATTAACCTT TCTTAGTTGT TGCTCTATAT CAACCTTTTA
TGCTTTTGCT CACTGTCGGT TTCTGCATGT TGATCTTTCA CTACTCCAGG ACCTGTCTGA ACTCTTTACA CCTCTAACTG
CTGAAGAGGA AAATGAAGTT CATAATTGTT TGTTTGGTAG GGGTTCAAGG TACCTTTGAT GACCCTGCTG CATGTTGTTT
GTAGCTTCTA TGTTTGTTGC TATAACAATT GATCATCACT CTTTTGTCCT TACAGTACTG AAATCCTAGC ACTGCATGAG
CCCTCCAACA TTGAAGTTAG CAGAGAGAAG TTCCGGTGCT TGAGACTGAC TGCCTGGTTA AATGATGAGG TAACTATCTA
TCTTGAATAT ACTTATATAT GAAACAAACT CCACTAGTAT CTATGGTTTA CTTCCTTTTT TTAAAAAAAA GATTGATGGT
TTACATGGAC CGGCGATGAC CCTGCCCATA TTATCTTACG TAATGAGGGC ATGTATTCCT CTTACATGCA GGTCATTAAT
TTGTACCTTG AATTATTGAA GGAGAGAGAG GCAAGAGAAC CAAAAAGGTT TTTGAAATGC CATTTCTTTA ATACATTTTT
TTATAAGAAG GTTAGATCAT AAGCTTCTTT TGCTTTCACG TATTCTATCT TCGTATTCAT ATTAAATGTT CTTATCGTCT
CTGTACTTTA TAACTTTTTT TAGCATTTCT GGTGTATTAT TGGTTTATAA GGATTTGGTG CAATGAACTT ATGAGTGTTC
AAATATGATA TCACTGTAGG AACATTTATA TTATATTTCA GTTGTGTTAT TAATTTATGG ACATTTTTAG AGTTTTTCCC
TCAGGAGGTA TATAGGTAAT AACTGTCCAG ATATCTTCAT GGGTTTCTCA GGTTAACATC ATTACTGGCT TTGGAGCCTT
AATTGGACAC AAATACTCAA TTAGCTTGTG TTTATGGCAT ATTAACTAAT ATGCTATTCA TTTGGCTCAT TTAGGTATAT
ATTAATTCAT CCATAGAAAA TTATAGGgca tattatatat tgaaaagtca aactttatag attctgacca acaattactc
aaatcataaa tatatttggt gtatcagaat tatactgata gattcatatT TCTGAGAGCT TTTCATAAAA TGTTGGTTGC
GCAGATATTA CGAATGTAAT TTATG

Locus: Os03g0344300

Loading...

Locus: Os03g0344300

Loading...