Os03t0356414-01

Locus

Os03g0356414

Description

C3HC4 RING finger E3 ligase, SINA type E3 ligase, Negative regulation of drought stress tolerance

RAP-DB Gene Symbol Synonym(s)

OsDIS1

RAP-DB Gene Name Synonym(s)

drought-induced SINA protein 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDIS1

Oryzabase Gene Name Synonym(s)

drought-induced SINA protein 1, drought induced seven in absentia (SINA) protein 1, drought induced seven in absentia protein 1

Transcript Evidence

AK058336

Protein Evidence

Q10L91

Literature

PMID: 22067990

PMID: 21719639

Note

Manual Curation

August 6, 2020

Gene Ontology (GO)

Biological Process: ubiquitin-dependent protein catabolic process (GO:0006511)

Biological Process: multicellular organism development (GO:0007275)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

TRAF-like (IPR008974)

Zinc finger, RING-type (IPR001841)

Seven-in-absentia protein, TRAF-like domain (IPR018121)

Zinc finger, SIAH-type (IPR013010)

Experimentally confirmed subcellular location

nucleus (GO:0005634) [mainly]

cytoplasm (GO:0005737)

plasma membrane (GO:0005886)

Full-length cDNA

001-014-D03 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0356414-01)

Others

Oryzabase (9920)

KEGG (Os03t0356414-01 (EC:2.3.2.27))

Transcript

1490 bp

>Os03t0356414-01 C3HC4 RING finger E3 ligase, SINA type E3 ligase, Negative regulation of drought stress tolerance
AAAAAACGCGAGAAGAGAGAGAGAGAAGCTTTTAATTCGAATTCTCTCTCTCATCACGGC
TTCTTCTGCTTCTCCTTCTCCTCCCCCCTCATCCCTCCTCCGCCGGTAGCCGCCGGCCGG
GAGCGAGCAGCGAGCGAGACCGGAGCCCGCCGGAGCCGGTCTCGCTCCCCCCTCCTCCCT
TGTTCGCGCCACCCCCGAGGACCCCTTACAATATCTAGTGTATTTATGGCCTCAGTTACT
TATATTGATGACTCCGGTTCTGAGGTAATTGATCCTCCAAAGACTGAGGTGCTGGATGTT
ACCGAACTTGCTGGTGATCCTGTTCCGCATTCACCAAAACCAAATGTGGTAGTTTCTAGC
AGTGTGCGTGAACTGCTTGAATGTCCAGTCTGCCTGAGCGCAATGTATCCTCCCATTCAT
CAGTGCTCTAATGGTCATACATTGTGCTCTGGATGCAAACCAAGGGTTCACAATCGCTGT
CCAACTTGTAGGCATGAACTGGGTAATATTAGATGTCTTGCTCTCGAGAAGGTGGCTGCG
TCGCTTGAACTTCCATGCAAGTACCAGAACTTCGGGTGTGTAGGCATTTATCCTTACTAC
TGCAAGCTGAAGCATGAGTCACAGTGCCAATATAGGCCTTATAGCTGTCCATATGCTGGA
TCTGAATGCACAGTTGCTGGTGACATTCCATACTTGGTGAATCACTTGAAAGATGACCAC
AAGGTTGACATGCATAATGGCTGCACCTTCAACCATCGCTATGTCAAGTCGAATCCTCAT
GAAGTTGAGAATGCCACCTGGATGCTTACGGTTTTCAGCTGCTTTGGCCAGTACTTCTGC
CTACATTTCGAAGCATTTCAGCTGGGGATGGCACCTGTGTACATCGCCTTCCTGAGGTTC
ATGGGTGATGACTTGGAAGCAAAGAACTACAGCTACAGCCTGGAGGTAGGAGGCACTGGC
CGCAAAATGATCTGGCAAGGGGTTCCCCGGAGCATCAGAGACAGCCATCGGAAGGTCCGG
GATAGCTATGATGGGCTTATCATCCAACGGAACATGGCCTTGTTCTTCTCTGGTGGAGAA
AGGAAGGAGCTCAAATTGCGGGTCACTGGGAGAATTTGGAAGGAACAGTGAAAATAAAAT
GTGAAATGATCTGTTCATCGTTCTTAACCCTTGCATGAACCTATGTATCATCACAGTGCG
AGAATTATAGCCATTCATAGGCAGTGACTCTAAAATGAAGACTTGTAATGTTATTAGCTT
GTTTTAGCTACCATCTTCTGTTAGATTGGTGCCTGTGGATGACTAGATGACAGTCATGTA
GACCAGAGTGGCACTATTGTAGAATTCCTGGCAAACTTCTCTTTGCCTTGAACTGCTTGT
TGAGTTGCCATTCTGTGGTATAGGGAAATCTAATGGCAATTCATGAGATGAATGTGTTGA
ACTCTTTTTCATGTTTCCAGCATATTTCTAGCTTCTTTGTTCATTCTTTC

CDS

906 bp

>Os03t0356414-01 C3HC4 RING finger E3 ligase, SINA type E3 ligase, Negative regulation of drought stress tolerance
ATGGCCTCAGTTACTTATATTGATGACTCCGGTTCTGAGGTAATTGATCCTCCAAAGACT
GAGGTGCTGGATGTTACCGAACTTGCTGGTGATCCTGTTCCGCATTCACCAAAACCAAAT
GTGGTAGTTTCTAGCAGTGTGCGTGAACTGCTTGAATGTCCAGTCTGCCTGAGCGCAATG
TATCCTCCCATTCATCAGTGCTCTAATGGTCATACATTGTGCTCTGGATGCAAACCAAGG
GTTCACAATCGCTGTCCAACTTGTAGGCATGAACTGGGTAATATTAGATGTCTTGCTCTC
GAGAAGGTGGCTGCGTCGCTTGAACTTCCATGCAAGTACCAGAACTTCGGGTGTGTAGGC
ATTTATCCTTACTACTGCAAGCTGAAGCATGAGTCACAGTGCCAATATAGGCCTTATAGC
TGTCCATATGCTGGATCTGAATGCACAGTTGCTGGTGACATTCCATACTTGGTGAATCAC
TTGAAAGATGACCACAAGGTTGACATGCATAATGGCTGCACCTTCAACCATCGCTATGTC
AAGTCGAATCCTCATGAAGTTGAGAATGCCACCTGGATGCTTACGGTTTTCAGCTGCTTT
GGCCAGTACTTCTGCCTACATTTCGAAGCATTTCAGCTGGGGATGGCACCTGTGTACATC
GCCTTCCTGAGGTTCATGGGTGATGACTTGGAAGCAAAGAACTACAGCTACAGCCTGGAG
GTAGGAGGCACTGGCCGCAAAATGATCTGGCAAGGGGTTCCCCGGAGCATCAGAGACAGC
CATCGGAAGGTCCGGGATAGCTATGATGGGCTTATCATCCAACGGAACATGGCCTTGTTC
TTCTCTGGTGGAGAAAGGAAGGAGCTCAAATTGCGGGTCACTGGGAGAATTTGGAAGGAA
CAGTGA

Protein

302 aa

>Os03t0356414-01 C3HC4 RING finger E3 ligase, SINA type E3 ligase, Negative regulation of drought stress tolerance
MASVTYIDDSGSEVIDPPKTEVLDVTELAGDPVPHSPKPNVVVSSSVRELLECPVCLSAM
YPPIHQCSNGHTLCSGCKPRVHNRCPTCRHELGNIRCLALEKVAASLELPCKYQNFGCVG
IYPYYCKLKHESQCQYRPYSCPYAGSECTVAGDIPYLVNHLKDDHKVDMHNGCTFNHRYV
KSNPHEVENATWMLTVFSCFGQYFCLHFEAFQLGMAPVYIAFLRFMGDDLEAKNYSYSLE
VGGTGRKMIWQGVPRSIRDSHRKVRDSYDGLIIQRNMALFFSGGERKELKLRVTGRIWKE
Q*

5'UTR

chr03:13637293..13637491 (- strand) : 199 bp

chr03:13635813..13635838 (- strand) : 26 bp

CDS

chr03:13635615..13635812 (- strand) : 198 bp

chr03:13634876..13635262 (- strand) : 387 bp

chr03:13634091..13634411 (- strand) : 321 bp

3'UTR

chr03:13633732..13634090 (- strand) : 359 bp

FASTA

>Os03t0356414-01 class=Sequence position=chr03:13633732..13637491 (- strand)
AAAAAACGCG AGAAGAGAGA GAGAGAAGCT TTTAATTCGA ATTCTCTCTC TCATCACGGC TTCTTCTGCT TCTCCTTCTC
CTCCCCCCTC ATCCCTCCTC CGCCGGTAGC CGCCGGCCGG GAGCGAGCAG CGAGCGAGAC CGGAGCCCGC CGGAGCCGGT
CTCGCTCCCC CCTCCTCCCT TGTTCGCGCC ACCCCCGAGG TACATCCCGC CGATCTCTCT CTTTCTCTCT CTCGTTGGTC
TGCTCTGTGA TTTTTTTTTT TTTTGCCAAG GCTGTTCTTT ATTTGGCACA GAGATTGTTT TTTTTTTCCT TCTTTGCGGG
TGTCCGGTTC GAGTCCACGG GGTTTGACTC TGCCGGAAAT GGTTCGAATG CGGCGGCCGG AGGGCGGAGG AGGGGTTTTG
GGGGGCGTTC TTGGTGGGTT GGTTTGCGCC GAGTCTTTGT TAATTTGTTA GGGTTCTTGA TCTGATGCGG CTTCTCGTTG
CCGGGATGCG CTTGCCTCAT GGCTGAATTC AAACAGGCCG GTCTCTCTCT CCCTCCCTCT CTCCCGTCAG CCGTGTGCTT
TGACCGAGTA AGTTTTTGAA CTTCGATTGG TTGAGCTGGG GGTTCTTGAC TTTTTCTTAC TCCACGAATG TTCCTTTTTG
CACAATGGGG CTACTAATGA ATGGAAAGCT AGAGATGGTG TGCCTAATGG TGATGTGCCG TCATTGTGTT AGCTCGGATT
TGTACTGCGA ATTTGCGAGC TCACATGCTC AGCTGATGAT GTGTTGATCC AGGGAGTATA TATAATTGGT TGGTAGAGTA
CTTGCTAGAT TGTGCTCACG GGTCTCATTT CAAAGTTCAG TATGAAATCT TGGTTGTAAA GTAGTACTAG TGTTTTGTTA
ATCGTTAGGG AGTACTTCTC CTGCATTTTT CTTAATTTTT TCCCTTTAAA AACTGTAGGT GGATTTGTTA TTAGTAAAGC
TGATTTGTGC CAAATAGAAA TTCTGTTTTA TCCGCAGTAA GGTACTGTAA ACAGTACTTG CAGGCACTAG GGTTTATTGG
CAAGGTTTTC TATGTTACAT TTTAATAAAT GCCACCTTTT TCTTCGTCAA AAGAAGCCAC GGTTATAAAG AAAAAGTGAA
GCATTAATTG ATGTAAATGC ACGAACTACA AATTTCCACA AATATAAACC TTTTAATAAA ATCCACAAAT GAAAGAAAAA
TGCAGTTCAC ACACCAATCT CTTTCTCAAA ATTTACACTT TTCTTATAAC AGGTATGCTA AATTTTCTTA ATACAAAGCA
TATACAAAAC ATCACAAGCA CTATAGACAT TCATGACATA TCTGTTGCAT AGGACAATAT GCAGTATGAA GACCTGGCTG
GTCAAAACTT CCGATGCACA TGTGAGGCCC TATCCATGTG CTTTCTTGAT TTCTGCTCCT TTATGGCCCT ATCTCCTTCA
AAGCCCTTAA ACACTTCAAC AGTGTCCAAT CATACTATGA GACTGTATGG ATATGGGCAT ATGGCTATAC TTTTGATGAG
GCAATGATTT TTTTTGTTAA TAATAGTGTT AATAGGAAGT GTTGAATTGG TTTTTTAAAA GGAAGTATTT AAGCATTGAA
TTTGTCATTT ATTTTGACTC ACTAATAACA CAGATAGTTC TCTTTCCTAG CAGGACCCCT TACAATATCT AGTGTATTTA
TGGCCTCAGT TACTTATATT GATGACTCCG GTTCTGAGGT AATTGATCCT CCAAAGACTG AGGTGCTGGA TGTTACCGAA
CTTGCTGGTG ATCCTGTTCC GCATTCACCA AAACCAAATG TGGTAGTTTC TAGCAGTGTG CGTGAACTGC TTGAATGTCC
AGTCTGCCTG AGCGCAATGT ATCCTCCCAT TCATCAGGTG CACATATACC ACTTATTGAA TCTTTTTTGC ACTTAAAAAG
GATATTTTCT TGTATGGAAG TCACTTGGGA AACAAAATGC GTGTTTCATT TAATTGCATT GCTTTTACTA TCTTGAATCC
TGCTATCATA TTTGTAGTCT GGCCTGATCT ATTTGAACTT ATCTAGATGA TTTCCTGGTT TAAAACGGTC GTTCTGAGCT
GCTTTTTCAC ATATGTTCTG TTCCACTACC AAATTGTTAC CCATGTATTT AAGCACCAAA AAAGAAGTTA GCTAAGATAG
TATGTACAAT ATGCACATTG TTGTACTATG TTGTAAGTTG TAACCCCAAC TCTTTTTCTG CTAATGCAGT GCTCTAATGG
TCATACATTG TGCTCTGGAT GCAAACCAAG GGTTCACAAT CGCTGTCCAA CTTGTAGGCA TGAACTGGGT AATATTAGAT
GTCTTGCTCT CGAGAAGGTG GCTGCGTCGC TTGAACTTCC ATGCAAGTAC CAGAACTTCG GGTGTGTAGG CATTTATCCT
TACTACTGCA AGCTGAAGCA TGAGTCACAG TGCCAATATA GGCCTTATAG CTGTCCATAT GCTGGATCTG AATGCACAGT
TGCTGGTGAC ATTCCATACT TGGTGAATCA CTTGAAAGAT GACCACAAGG TTGACATGCA TAATGGCTGC ACCTTCAACC
ATCGCTATGT CAAGTCGAAT CCTCATGAAG TTGAGAATGC CACCTGGATG CTTACGGTAT CCCCTCGTTA ACTCCACCAT
GTTAGTTATT GTGAAGTATA TCACTGATGT TTACTTATGC AAAGATTGGT TCACTTGTCT GCTAAGATAG TCCATATTTC
TGTACTGAGT TTTATGAGCC TTTCTGTAAA AATAAACATT GGTTCACTTG TACAGTATGA TTGCACTCTG TACTTTTCAT
GTCAACTGAG GATGCTGATC ATGCAGCATA GTTATTGGTC TAAAATAATC TCTCACCTAT GAAGAAACTA TGCATCAGAA
TATCCATCTG CTTCCATTTC CAAAAAAAAA AAAAAAAACT TTGTCTGCTT TACAGCACAA TAATAGCATT TGGACAGGGC
TCTTGATCTG CAACCTTTTC TTGCTGCTTT CTAAGTGCAA TATAAAATTA AGAATTTCCT TCTAATCTGT TCTTTTCCAT
TGAACAAAAT GGACTAAGTA ACTATAATGC TTCCATCTAG GTTTTCAGCT GCTTTGGCCA GTACTTCTGC CTACATTTCG
AAGCATTTCA GCTGGGGATG GCACCTGTGT ACATCGCCTT CCTGAGGTTC ATGGGTGATG ACTTGGAAGC AAAGAACTAC
AGCTACAGCC TGGAGGTAGG AGGCACTGGC CGCAAAATGA TCTGGCAAGG GGTTCCCCGG AGCATCAGAG ACAGCCATCG
GAAGGTCCGG GATAGCTATG ATGGGCTTAT CATCCAACGG AACATGGCCT TGTTCTTCTC TGGTGGAGAA AGGAAGGAGC
TCAAATTGCG GGTCACTGGG AGAATTTGGA AGGAACAGTG AAAATAAAAT GTGAAATGAT CTGTTCATCG TTCTTAACCC
TTGCATGAAC CTATGTATCA TCACAGTGCG AGAATTATAG CCATTCATAG GCAGTGACTC TAAAATGAAG ACTTGTAATG
TTATTAGCTT GTTTTAGCTA CCATCTTCTG TTAGATTGGT GCCTGTGGAT GACTAGATGA CAGTCATGTA GACCAGAGTG
GCACTATTGT AGAATTCCTG GCAAACTTCT CTTTGCCTTG AACTGCTTGT TGAGTTGCCA TTCTGTGGTA TAGGGAAATC
TAATGGCAAT TCATGAGATG AATGTGTTGA ACTCTTTTTC ATGTTTCCAG CATATTTCTA GCTTCTTTGT TCATTCTTTC

Locus: Os03g0356414

Loading...

Locus: Os03g0356414

Loading...