Os03t0364400-01

Locus

Os03g0364400

Description

Receptor-like cytoplasmic kinase, Leaf senescence, Salt stress response

RAP-DB Gene Symbol Synonym(s)

OsBBS1, OsRLCK109

RAP-DB Gene Name Synonym(s)

bilateral blade senescence 1, Receptor-like Cytoplasmic Kinase 109

CGSNL Gene Symbol

BBS1

CGSNL Gene Name

BILATERAL BLADE SENESCENCE 1

Oryzabase Gene Symbol Synonym(s)

OsRLCK109, RLCK109, OsBBS1, OSBBS1/OsRLCK109

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 109, bilateral blade senescence 1

Transcript Evidence

AK066529

Protein Evidence

Q10KZ7

Literature

PMID: 29572657

Note

Manual Curation

March 26, 2018

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Serine-threonine/tyrosine-protein kinase, catalytic domain (IPR001245)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J013073L01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0364400-01)

RiceXPro (AK066529)

Others

Oryzabase (18817)

KEGG (Os03t0364400-01)

Transcript

1889 bp

>Os03t0364400-01 Receptor-like cytoplasmic kinase, Leaf senescence, Salt stress response
GGCTCGGATCGGAGCAGTTGGCTGCAGCCGCAGTTTGTTGGAGCGGTTGGCCCTCGCACT
CGCACTACCCCCCGCCCTTTTTCTCCCGCCATATTTCTACTTCTCCCGGCCCACCCCCCC
TCAGCTCGCCCTCCTCCCGCCCCCCACCTGCTCGATCTCCACTCCGTCTCCATCTCCATC
CGATCCAAGATGCCGCCGAGGCAGTGGAGGCCGATGCTGGCGTCGGCGACCAAGTGCTGC
GCGGCGGAGGACGCGGTGGTGGCGGTGGATGGCAGCGGCGGCGGGGGCGGCCTCGCGCGG
TGCAGGCCGGCGCGGTCCGAGTTCTCACGGAGGCTGGCGTCGTTCCGGAAGCTGTCGTCG
ATGACCAACAGCCCGGCGTCGTCCGTCGCGGGGGCGGCGGAGGGGGGGAAAGACGACGGC
GAGGAGGGGGGCGGCGGCGGTGGCGGCGTGTCCGGCCCGCTGCAGCTCTACTCCTTCAGC
TTCTCCGAGCTCCGGTCCATCACGCACGACTTCTCCAGCAGCTACCTGCTCGGGGAGGGC
GGCTTCGGCGCCGTCCACAAGGGCTTCGTCGACGCCGGCATGCGCCCCGGCCTCCTGCCC
CAGCCCGTCGCCGTCAAGCAGCTCGACATCGCCGGCCTCCAGGGCCACCGGGAGTGGCTG
GCGGAGGTGATCTTCTTGGGGCAGTTCCGGCACCCGCACCTGGTGAAGCTGCTGGGCTAC
TGCTGCGAGGACGAGGAGCGCCTCCTCGTCTACGAGTTCATGCCGCGCGGCAGCCTCGAG
AACCACCTCTTCAAGAGGATATCGGCGACGGTGCCGTGGGGCacgcgtctgaagatcgcc
atcggcgccgccaagggcctcgccttcctccacggcgcctccacccccgtcatctaccgc
gacttcaaggcctccaacatcctcctcgactcgGAGTTCACGGCGAAGCTGTCGgacttc
gggctggcgaagatggggccggagggttcggagactcacgtgacgacgcgggtgatgggc
acgcacgggtacgcggcgccggagtacgtgatgacggggcacctcaacatcaagagcgac
gtgtacagctacggCGTCGTGCTCCTGGAGCTCCTGACGGGGCGGCGCGCCATGGAGCAT
GTCAGGGGGAGGAGCCTCCACGCCGACCAGGTGGTCAAGATCGTCGACTGGACCCGCCCC
TACCTCGGCagcagccgccgcctccgctgcatcatggacccgcgcctcgccggccactac
tccgtcaaggccgcccgcgccgtcgcccacctcgccgtccagtgcaccagcccgcagccg
cgcgaccgcccgcgcatggccgccgtcgtcgacgccctcgagcgcctgcagggcttcaag
gacatggccgtcaccgtcggcctctggcccaccaacgcccccgtcgccggcaggaacgcc
atctccgccaagatccgcgccgaggtcagaggcgccggctccggcggcggcgcggcctcg
cggcggcggagcgcctccgccAAGCTGCCCTGATCGCCCGCGTGCGTTCGTGGGCGCGCC
ACGTCATCGCGAGTACGTATTTGTATACGTGTACGTGTGTGTATATACTTTAGCTGCTGT
ATAAGATGGCACGGCCGATGTATTGTACGTGGTGATCATCGAGCTTGATTGATTTTTTTT
TAGCCATATGGATTATGGATTATTGCGGAATTAATACTGATCTGTATCACCATATGTACG
TACTTAGTAGGAGTATTTAGTTTTAGGTGCCATGATGCTGGTAGATCATGCATGCATGTA
TGATGAATTGTACTTTCATCCACCGATTGCTGATTGCAAGTTCGTGCATCAGTAATCGGT
CATTTCGATATTATCTTTTTTTTTCCTTG

CDS

1344 bp

>Os03t0364400-01 Receptor-like cytoplasmic kinase, Leaf senescence, Salt stress response
ATGCCGCCGAGGCAGTGGAGGCCGATGCTGGCGTCGGCGACCAAGTGCTGCGCGGCGGAG
GACGCGGTGGTGGCGGTGGATGGCAGCGGCGGCGGGGGCGGCCTCGCGCGGTGCAGGCCG
GCGCGGTCCGAGTTCTCACGGAGGCTGGCGTCGTTCCGGAAGCTGTCGTCGATGACCAAC
AGCCCGGCGTCGTCCGTCGCGGGGGCGGCGGAGGGGGGGAAAGACGACGGCGAGGAGGGG
GGCGGCGGCGGTGGCGGCGTGTCCGGCCCGCTGCAGCTCTACTCCTTCAGCTTCTCCGAG
CTCCGGTCCATCACGCACGACTTCTCCAGCAGCTACCTGCTCGGGGAGGGCGGCTTCGGC
GCCGTCCACAAGGGCTTCGTCGACGCCGGCATGCGCCCCGGCCTCCTGCCCCAGCCCGTC
GCCGTCAAGCAGCTCGACATCGCCGGCCTCCAGGGCCACCGGGAGTGGCTGGCGGAGGTG
ATCTTCTTGGGGCAGTTCCGGCACCCGCACCTGGTGAAGCTGCTGGGCTACTGCTGCGAG
GACGAGGAGCGCCTCCTCGTCTACGAGTTCATGCCGCGCGGCAGCCTCGAGAACCACCTC
TTCAAGAGGATATCGGCGACGGTGCCGTGGGGCacgcgtctgaagatcgccatcggcgcc
gccaagggcctcgccttcctccacggcgcctccacccccgtcatctaccgcgacttcaag
gcctccaacatcctcctcgactcgGAGTTCACGGCGAAGCTGTCGgacttcgggctggcg
aagatggggccggagggttcggagactcacgtgacgacgcgggtgatgggcacgcacggg
tacgcggcgccggagtacgtgatgacggggcacctcaacatcaagagcgacgtgtacagc
tacggCGTCGTGCTCCTGGAGCTCCTGACGGGGCGGCGCGCCATGGAGCATGTCAGGGGG
AGGAGCCTCCACGCCGACCAGGTGGTCAAGATCGTCGACTGGACCCGCCCCTACCTCGGC
agcagccgccgcctccgctgcatcatggacccgcgcctcgccggccactactccgtcaag
gccgcccgcgccgtcgcccacctcgccgtccagtgcaccagcccgcagccgcgcgaccgc
ccgcgcatggccgccgtcgtcgacgccctcgagcgcctgcagggcttcaaggacatggcc
gtcaccgtcggcctctggcccaccaacgcccccgtcgccggcaggaacgccatctccgcc
aagatccgcgccgaggtcagaggcgccggctccggcggcggcgcggcctcgcggcggcgg
agcgcctccgccAAGCTGCCCTGA

Protein

448 aa

>Os03t0364400-01 Receptor-like cytoplasmic kinase, Leaf senescence, Salt stress response
MPPRQWRPMLASATKCCAAEDAVVAVDGSGGGGGLARCRPARSEFSRRLASFRKLSSMTN
SPASSVAGAAEGGKDDGEEGGGGGGGVSGPLQLYSFSFSELRSITHDFSSSYLLGEGGFG
AVHKGFVDAGMRPGLLPQPVAVKQLDIAGLQGHREWLAEVIFLGQFRHPHLVKLLGYCCE
DEERLLVYEFMPRGSLENHLFKRISATVPWGTRLKIAIGAAKGLAFLHGASTPVIYRDFK
ASNILLDSEFTAKLSDFGLAKMGPEGSETHVTTRVMGTHGYAAPEYVMTGHLNIKSDVYS
YGVVLLELLTGRRAMEHVRGRSLHADQVVKIVDWTRPYLGSSRRLRCIMDPRLAGHYSVK
AARAVAHLAVQCTSPQPRDRPRMAAVVDALERLQGFKDMAVTVGLWPTNAPVAGRNAISA
KIRAEVRGAGSGGGAASRRRSASAKLP*

5'UTR

chr03:14206981..14207169 (+ strand) : 189 bp

CDS

chr03:14207170..14207640 (+ strand) : 471 bp

chr03:14207754..14207889 (+ strand) : 136 bp

chr03:14207998..14208134 (+ strand) : 137 bp

chr03:14208205..14208804 (+ strand) : 600 bp

3'UTR

chr03:14208805..14209160 (+ strand) : 356 bp

FASTA

>Os03t0364400-01 class=Sequence position=chr03:14206981..14209160 (+ strand)
GGCTCGGATC GGAGCAGTTG GCTGCAGCCG CAGTTTGTTG GAGCGGTTGG CCCTCGCACT CGCACTACCC CCCGCCCTTT
TTCTCCCGCC ATATTTCTAC TTCTCCCGGC CCACCCCCCC TCAGCTCGCC CTCCTCCCGC CCCCCACCTG CTCGATCTCC
ACTCCGTCTC CATCTCCATC CGATCCAAGA TGCCGCCGAG GCAGTGGAGG CCGATGCTGG CGTCGGCGAC CAAGTGCTGC
GCGGCGGAGG ACGCGGTGGT GGCGGTGGAT GGCAGCGGCG GCGGGGGCGG CCTCGCGCGG TGCAGGCCGG CGCGGTCCGA
GTTCTCACGG AGGCTGGCGT CGTTCCGGAA GCTGTCGTCG ATGACCAACA GCCCGGCGTC GTCCGTCGCG GGGGCGGCGG
AGGGGGGGAA AGACGACGGC GAGGAGGGGG GCGGCGGCGG TGGCGGCGTG TCCGGCCCGC TGCAGCTCTA CTCCTTCAGC
TTCTCCGAGC TCCGGTCCAT CACGCACGAC TTCTCCAGCA GCTACCTGCT CGGGGAGGGC GGCTTCGGCG CCGTCCACAA
GGGCTTCGTC GACGCCGGCA TGCGCCCCGG CCTCCTGCCC CAGCCCGTCG CCGTCAAGCA GCTCGACATC GCCGGCCTCC
AGGGCCACCG GGAGTGGCTG GTATGTCCAT GCTTACTGCT TTCTTTCCTC CTGCCAATTG GTACTGCTTT TCTCTGGTAG
TAGTTAAGCT CAAGTCGATG TCGTCCATGG CGGACATGGC GTGCACGGTG CAGGCGGAGG TGATCTTCTT GGGGCAGTTC
CGGCACCCGC ACCTGGTGAA GCTGCTGGGC TACTGCTGCG AGGACGAGGA GCGCCTCCTC GTCTACGAGT TCATGCCGCG
CGGCAGCCTC GAGAACCACC TCTTCAAGAG TACGCACTTA GCTATAGCTA GCTCCGGCCA CATCTCCGTT TCCGCGCCGC
CGCCGCCGCC GCCGCCGGCA CAAACTGACC GATTCGATCC ATGTCCATAT TGTGCAGGGA TATCGGCGAC GGTGCCGTGG
GGCacgcgtc tgaagatcgc catcggcgcc gccaagggcc tcgccttcct ccacggcgcc tccacccccg tcatctaccg
cgacttcaag gcctccaaca tcctcctcga ctcgGTACAC TACACACCAC CTAGCTCCTT CTTCTCCAAT TCGATCGATC
GCCCGAACTA ACTTGAGCTT GCAGGAGTTC ACGGCGAAGC TGTCGgactt cgggctggcg aagatggggc cggagggttc
ggagactcac gtgacgacgc gggtgatggg cacgcacggg tacgcggcgc cggagtacgt gatgacgggg cacctcaaca
tcaagagcga cgtgtacagc tacggCGTCG TGCTCCTGGA GCTCCTGACG GGGCGGCGCG CCATGGAGCA TGTCAGGGGG
AGGAGCCTCC ACGCCGACCA GGTGGTCAAG ATCGTCGACT GGACCCGCCC CTACCTCGGC agcagccgcc gcctccgctg
catcatggac ccgcgcctcg ccggccacta ctccgtcaag gccgcccgcg ccgtcgccca cctcgccgtc cagtgcacca
gcccgcagcc gcgcgaccgc ccgcgcatgg ccgccgtcgt cgacgccctc gagcgcctgc agggcttcaa ggacatggcc
gtcaccgtcg gcctctggcc caccaacgcc cccgtcgccg gcaggaacgc catctccgcc aagatccgcg ccgaggtcag
aggcgccggc tccggcggcg gcgcggcctc gcggcggcgg agcgcctccg ccAAGCTGCC CTGATCGCCC GCGTGCGTTC
GTGGGCGCGC CACGTCATCG CGAGTACGTA TTTGTATACG TGTACGTGTG TGTATATACT TTAGCTGCTG TATAAGATGG
CACGGCCGAT GTATTGTACG TGGTGATCAT CGAGCTTGAT TGATTTTTTT TTAGCCATAT GGATTATGGA TTATTGCGGA
ATTAATACTG ATCTGTATCA CCATATGTAC GTACTTAGTA GGAGTATTTA GTTTTAGGTG CCATGATGCT GGTAGATCAT
GCATGCATGT ATGATGAATT GTACTTTCAT CCACCGATTG CTGATTGCAA GTTCGTGCAT CAGTAATCGG TCATTTCGAT
ATTATCTTTT TTTTTCCTTG