Os03t0364400-02

Locus

Os03g0364400

Description

Similar to Phytosulfokine receptor-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BBS1

CGSNL Gene Name

BILATERAL BLADE SENESCENCE 1

Oryzabase Gene Symbol Synonym(s)

OsRLCK109, RLCK109, OsBBS1, OSBBS1/OsRLCK109

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 109, bilateral blade senescence 1

Transcript Evidence

AK071963 (DDBJ, Best hit)

Protein Evidence

C6ZRV7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine-threonine/tyrosine-protein kinase (IPR001245)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Full-length cDNA

J013078M18 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0364400-02)

RiceXPro (AK071963)

Others

Oryzabase (18817)

KEGG (Os03t0364400-02)

Transcript

1767 bp

>Os03t0364400-02 Similar to Phytosulfokine receptor-like protein.
AGCTCGCCCTCCTCCCGCCCCCCACCTGCTCGATCTCCACTCCGTCTCCATCTCCATCCG
ATCCAAGATGCCGCCGAGGCAGTGGAGGCCGATGCTGGCGTCGGCGACCAAGTGCTGCGC
GGCGGAGGACGCGGTGGTGGCGGTGGATGGCAGCGGCGGCGGGGGCGGCCTCGCGCGGTG
CAGGCCGGCGCGGTCCGAGTTCTCACGGAGGCTGGCGTCGTTCCGGAAGCTGTCGTCGAT
GACCAACAGCCCGGCGTCGTCCGTCGCGGGGGCGGCGGAGGGGGGGAAAGACGACGGCGA
GGAGGGGGGCGGCGGCGGTGGCGGCGTGTCCGGCCCGCTGCAGCTCTACTCCTTCAGCTT
CTCCGAGCTCCGGTCCATCACGCACGACTTCTCCAGCAGCTACCTGCTCGGGGAGGGCGG
CTTCGGCGCCGTCCACAAGGGCTTCGTCGACGCCGGCATGCGCCCCGGCCTCCTGCCCCA
GCCCGTCGCCGTCAAGCAGCTCGACATCGCCGGCCTCCAGGGCCACCGGGAGTGGCTGGC
GGAGGTGATCTTCTTGGGGCAGTTCCGGCACCCGCACCTGGTGAAGCTGCTGGGCTACTG
CTGCGAGGACGAGGAGCGCCTCCTCGTCTACGAGTTCATGCCGCGCGGCAGCCTCGAGAA
CCACCTCTTCAAGAGGATATCGGCGACGGTGCCGTGGGGCacgcgtctgaagatcgccat
cggcgccgccaagggcctcgccttcctccacggcgcctccacccccgtcatctaccgcga
cttcaaggcctccaacatcctcctcgactcgGAGTTCACGGCGAAGCTGTCGgacttcgg
gctggcgaagatggggccggagggttcggagactcacgtgacgacgcgggtgatgggcac
gcacgggtacgcggcgccggagtacgtgatgacggggcacctcaacatcaagagcgacgt
gtacagctacggCGTCGTGCTCCTGGAGCTCCTGACGGGGCGGCGCGCCATGGAGCATGT
CAGGGGGAGGAGCCTCCACGCCGACCAGGTGGTCAAGATCGTCGACTGGACCCGCCCCTA
CCTCGGCagcagccgccgcctccgctgcatcatggacccgcgcctcgccggccactactc
cgtcaaggccgcccgcgccgtcgcccacctcgccgtccagtgcaccagcccgcagccgcg
cgaccgcccgcgcatggccgccgtcgtcgacgccctcgagcgcctgcagggcttcaagga
catggccgtcaccgtcggcctctggcccaccaacgcccccgtcgccggcaggaacgccat
ctccgccaagatccgcgccgaggtcagaggcgccggctccggcggcggcgcggcctcgcg
gcggcggagcgcctccgccAAGCTGCCCTGATCGCCCGCGTGCGTTCGTGGGCGCGCCAC
GTCATCGCGAGTACGTATTTGTATACGTGTACGTGTGTGTATATACTTTAGCTGCTGTAT
AAGATGGCACGGCCGATGTATTGTACGTGGTGATCATCGAGCTTGATTGATTTTTTTTTA
GCCATATGGATTATGGATTATTGCGGAATTAATACTGATCTGTATCACCATATGTACGTA
CTTAGTAGGAGTATTTAGTTTTAGGTGCCATGATGCTGGTAGATCATGCATGCATGTATG
ATGAATTGTACTTTCATCCACCGATTGCTGATTGCAAGTTCGTGCATCAGTAATCGGTCA
TTTCGATATTATCTTTTTTTTTCCTTG

CDS

1344 bp

>Os03t0364400-02 Similar to Phytosulfokine receptor-like protein.
ATGCCGCCGAGGCAGTGGAGGCCGATGCTGGCGTCGGCGACCAAGTGCTGCGCGGCGGAG
GACGCGGTGGTGGCGGTGGATGGCAGCGGCGGCGGGGGCGGCCTCGCGCGGTGCAGGCCG
GCGCGGTCCGAGTTCTCACGGAGGCTGGCGTCGTTCCGGAAGCTGTCGTCGATGACCAAC
AGCCCGGCGTCGTCCGTCGCGGGGGCGGCGGAGGGGGGGAAAGACGACGGCGAGGAGGGG
GGCGGCGGCGGTGGCGGCGTGTCCGGCCCGCTGCAGCTCTACTCCTTCAGCTTCTCCGAG
CTCCGGTCCATCACGCACGACTTCTCCAGCAGCTACCTGCTCGGGGAGGGCGGCTTCGGC
GCCGTCCACAAGGGCTTCGTCGACGCCGGCATGCGCCCCGGCCTCCTGCCCCAGCCCGTC
GCCGTCAAGCAGCTCGACATCGCCGGCCTCCAGGGCCACCGGGAGTGGCTGGCGGAGGTG
ATCTTCTTGGGGCAGTTCCGGCACCCGCACCTGGTGAAGCTGCTGGGCTACTGCTGCGAG
GACGAGGAGCGCCTCCTCGTCTACGAGTTCATGCCGCGCGGCAGCCTCGAGAACCACCTC
TTCAAGAGGATATCGGCGACGGTGCCGTGGGGCacgcgtctgaagatcgccatcggcgcc
gccaagggcctcgccttcctccacggcgcctccacccccgtcatctaccgcgacttcaag
gcctccaacatcctcctcgactcgGAGTTCACGGCGAAGCTGTCGgacttcgggctggcg
aagatggggccggagggttcggagactcacgtgacgacgcgggtgatgggcacgcacggg
tacgcggcgccggagtacgtgatgacggggcacctcaacatcaagagcgacgtgtacagc
tacggCGTCGTGCTCCTGGAGCTCCTGACGGGGCGGCGCGCCATGGAGCATGTCAGGGGG
AGGAGCCTCCACGCCGACCAGGTGGTCAAGATCGTCGACTGGACCCGCCCCTACCTCGGC
agcagccgccgcctccgctgcatcatggacccgcgcctcgccggccactactccgtcaag
gccgcccgcgccgtcgcccacctcgccgtccagtgcaccagcccgcagccgcgcgaccgc
ccgcgcatggccgccgtcgtcgacgccctcgagcgcctgcagggcttcaaggacatggcc
gtcaccgtcggcctctggcccaccaacgcccccgtcgccggcaggaacgccatctccgcc
aagatccgcgccgaggtcagaggcgccggctccggcggcggcgcggcctcgcggcggcgg
agcgcctccgccAAGCTGCCCTGA

Protein

448 aa

>Os03t0364400-02 Similar to Phytosulfokine receptor-like protein.
MPPRQWRPMLASATKCCAAEDAVVAVDGSGGGGGLARCRPARSEFSRRLASFRKLSSMTN
SPASSVAGAAEGGKDDGEEGGGGGGGVSGPLQLYSFSFSELRSITHDFSSSYLLGEGGFG
AVHKGFVDAGMRPGLLPQPVAVKQLDIAGLQGHREWLAEVIFLGQFRHPHLVKLLGYCCE
DEERLLVYEFMPRGSLENHLFKRISATVPWGTRLKIAIGAAKGLAFLHGASTPVIYRDFK
ASNILLDSEFTAKLSDFGLAKMGPEGSETHVTTRVMGTHGYAAPEYVMTGHLNIKSDVYS
YGVVLLELLTGRRAMEHVRGRSLHADQVVKIVDWTRPYLGSSRRLRCIMDPRLAGHYSVK
AARAVAHLAVQCTSPQPRDRPRMAAVVDALERLQGFKDMAVTVGLWPTNAPVAGRNAISA
KIRAEVRGAGSGGGAASRRRSASAKLP*

5'UTR

chr03:14207103..14207169 (+ strand) : 67 bp

CDS

chr03:14207170..14207640 (+ strand) : 471 bp

chr03:14207754..14207889 (+ strand) : 136 bp

chr03:14207998..14208134 (+ strand) : 137 bp

chr03:14208205..14208804 (+ strand) : 600 bp

3'UTR

chr03:14208805..14209160 (+ strand) : 356 bp

FASTA

>Os03t0364400-02 class=Sequence position=chr03:14207103..14209160 (+ strand)
AGCTCGCCCT CCTCCCGCCC CCCACCTGCT CGATCTCCAC TCCGTCTCCA TCTCCATCCG ATCCAAGATG CCGCCGAGGC
AGTGGAGGCC GATGCTGGCG TCGGCGACCA AGTGCTGCGC GGCGGAGGAC GCGGTGGTGG CGGTGGATGG CAGCGGCGGC
GGGGGCGGCC TCGCGCGGTG CAGGCCGGCG CGGTCCGAGT TCTCACGGAG GCTGGCGTCG TTCCGGAAGC TGTCGTCGAT
GACCAACAGC CCGGCGTCGT CCGTCGCGGG GGCGGCGGAG GGGGGGAAAG ACGACGGCGA GGAGGGGGGC GGCGGCGGTG
GCGGCGTGTC CGGCCCGCTG CAGCTCTACT CCTTCAGCTT CTCCGAGCTC CGGTCCATCA CGCACGACTT CTCCAGCAGC
TACCTGCTCG GGGAGGGCGG CTTCGGCGCC GTCCACAAGG GCTTCGTCGA CGCCGGCATG CGCCCCGGCC TCCTGCCCCA
GCCCGTCGCC GTCAAGCAGC TCGACATCGC CGGCCTCCAG GGCCACCGGG AGTGGCTGGT ATGTCCATGC TTACTGCTTT
CTTTCCTCCT GCCAATTGGT ACTGCTTTTC TCTGGTAGTA GTTAAGCTCA AGTCGATGTC GTCCATGGCG GACATGGCGT
GCACGGTGCA GGCGGAGGTG ATCTTCTTGG GGCAGTTCCG GCACCCGCAC CTGGTGAAGC TGCTGGGCTA CTGCTGCGAG
GACGAGGAGC GCCTCCTCGT CTACGAGTTC ATGCCGCGCG GCAGCCTCGA GAACCACCTC TTCAAGAGTA CGCACTTAGC
TATAGCTAGC TCCGGCCACA TCTCCGTTTC CGCGCCGCCG CCGCCGCCGC CGCCGGCACA AACTGACCGA TTCGATCCAT
GTCCATATTG TGCAGGGATA TCGGCGACGG TGCCGTGGGG Cacgcgtctg aagatcgcca tcggcgccgc caagggcctc
gccttcctcc acggcgcctc cacccccgtc atctaccgcg acttcaaggc ctccaacatc ctcctcgact cgGTACACTA
CACACCACCT AGCTCCTTCT TCTCCAATTC GATCGATCGC CCGAACTAAC TTGAGCTTGC AGGAGTTCAC GGCGAAGCTG
TCGgacttcg ggctggcgaa gatggggccg gagggttcgg agactcacgt gacgacgcgg gtgatgggca cgcacgggta
cgcggcgccg gagtacgtga tgacggggca cctcaacatc aagagcgacg tgtacagcta cggCGTCGTG CTCCTGGAGC
TCCTGACGGG GCGGCGCGCC ATGGAGCATG TCAGGGGGAG GAGCCTCCAC GCCGACCAGG TGGTCAAGAT CGTCGACTGG
ACCCGCCCCT ACCTCGGCag cagccgccgc ctccgctgca tcatggaccc gcgcctcgcc ggccactact ccgtcaaggc
cgcccgcgcc gtcgcccacc tcgccgtcca gtgcaccagc ccgcagccgc gcgaccgccc gcgcatggcc gccgtcgtcg
acgccctcga gcgcctgcag ggcttcaagg acatggccgt caccgtcggc ctctggccca ccaacgcccc cgtcgccggc
aggaacgcca tctccgccaa gatccgcgcc gaggtcagag gcgccggctc cggcggcggc gcggcctcgc ggcggcggag
cgcctccgcc AAGCTGCCCT GATCGCCCGC GTGCGTTCGT GGGCGCGCCA CGTCATCGCG AGTACGTATT TGTATACGTG
TACGTGTGTG TATATACTTT AGCTGCTGTA TAAGATGGCA CGGCCGATGT ATTGTACGTG GTGATCATCG AGCTTGATTG
ATTTTTTTTT AGCCATATGG ATTATGGATT ATTGCGGAAT TAATACTGAT CTGTATCACC ATATGTACGT ACTTAGTAGG
AGTATTTAGT TTTAGGTGCC ATGATGCTGG TAGATCATGC ATGCATGTAT GATGAATTGT ACTTTCATCC ACCGATTGCT
GATTGCAAGT TCGTGCATCA GTAATCGGTC ATTTCGATAT TATCTTTTTT TTTCCTTG