Os03t0366200-01

Locus

Os03g0366200

Description

Similar to Calcium/calmodulin-dependent serine/threonine-protein kinase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CRK1

CGSNL Gene Name

CDPK-RELATED KINASE 1

Oryzabase Gene Symbol Synonym(s)

OsCRK1, OsCBK, CBK

Oryzabase Gene Name Synonym(s)

CDPK-related kinase 1, Ca2+/calmodulin (CaM)-binding protein kinase, calmodulin-binding kinase

Transcript Evidence

AK059466 (DDBJ, Best hit)

Protein Evidence

Q10KY3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Protein kinase-like domain (IPR011009)

EF-hand-like domain (IPR011992)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

001-028-D08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0366200-01)

RiceXPro (AK059466)

Others

Oryzabase (10475)

KEGG (Os03t0366200-01 (EC:2.7.11.17))

Transcript

1149 bp

>Os03t0366200-01 Similar to Calcium/calmodulin-dependent serine/threonine-protein kinase 1.
ATTGTCGGAAGTGCATATTATGTTGCTCCTGAAGTGCTCCATCGATCTTATGGCACTGAG
GCAGATATGTGGAGCATTGGAGTAATAGTGTATATTTTGCTTTGTGGCAGCCGTCCTTTC
TGGGCACGTACTGAGTCAGGAATATTCCGAGCTGTGCTGAAAGCAGACCCTAGTTTTGAG
GAAGCCCCATGGCCAACCCTCTCTGCTGAAGCAAAAGACTTTGTAAGGAGGCTGCTCAAT
AAAGATTACCGCAAGAGGATGACTGCTGCACAAGCCCTCTGTCATCCATGGATTCGTGGT
ACTGAAGAAGTGAAGCTTCCTTTGGACATGATAATTTATAGGCTTATGAGGGCTTACATA
AGTTCATCTTCTTTACGGAGAGCTGCATTGAGGGCCCTTGCCAAGACATTGACAACAGAT
CAAATCTATTACCTAAGAGAACAGTTTGAATTGATAGGCCCAAACAAGAGCGATCTTATT
ACTTTGCAAAATTTGAAGACGGCCTTGATGAAGAACTCCACAAATGCAATGAAGGATTCT
AGGGTGGTTGACTTTGTTAACACAATATCCAATATTCAGTACAGAAAGTTGGATTTTGAG
GAGTTTTCTGCTGCTGCCATCAGTGTTTACCAGATGGAAGGTTTGGAAACCTGGGAACAA
CATGCCCGGCAAGCGTACGAGTTCTTTGATAAGGAGGGTAACCGACCAATTGTGATCGAC
GAGCTCGCATCGGAACTTGGATTGGGTCCTTCGGTTCCCCTACATGTTGTTCTCCAAGAT
TGGATCAGACATCCTGATGGAAAACTCAGCTTCCTTGGGTTCATGAAACTATTGCATGGA
GTTTCTTCGCGTACCATCCCAAAAACCTGAGATAATAACTTATTTTCTTACATCAACCAA
GGCAAAAGTGTGATGACTAAACTAATCTCTGGCTGTCTGGAGAAGCGGCATGGAACCAGT
ACAAAGATTAACAAAGCTGTCCTAGTGTAACAAGTGAAAAAGCTCTCCTGTCAGGCCCGC
GAATTTCGCCTTCTCTTACCAGATGATTGATGTTGTGTTTGTATTCAGGTTTGTTTAGAG
GTGAATGTACAGATGAGTTTAGGAAACAGGAAAAATGAGGTGCTAAGAAAGTGAAACATG
GTTTAATTT

CDS

870 bp

>Os03t0366200-01 Similar to Calcium/calmodulin-dependent serine/threonine-protein kinase 1.
ATTGTCGGAAGTGCATATTATGTTGCTCCTGAAGTGCTCCATCGATCTTATGGCACTGAG
GCAGATATGTGGAGCATTGGAGTAATAGTGTATATTTTGCTTTGTGGCAGCCGTCCTTTC
TGGGCACGTACTGAGTCAGGAATATTCCGAGCTGTGCTGAAAGCAGACCCTAGTTTTGAG
GAAGCCCCATGGCCAACCCTCTCTGCTGAAGCAAAAGACTTTGTAAGGAGGCTGCTCAAT
AAAGATTACCGCAAGAGGATGACTGCTGCACAAGCCCTCTGTCATCCATGGATTCGTGGT
ACTGAAGAAGTGAAGCTTCCTTTGGACATGATAATTTATAGGCTTATGAGGGCTTACATA
AGTTCATCTTCTTTACGGAGAGCTGCATTGAGGGCCCTTGCCAAGACATTGACAACAGAT
CAAATCTATTACCTAAGAGAACAGTTTGAATTGATAGGCCCAAACAAGAGCGATCTTATT
ACTTTGCAAAATTTGAAGACGGCCTTGATGAAGAACTCCACAAATGCAATGAAGGATTCT
AGGGTGGTTGACTTTGTTAACACAATATCCAATATTCAGTACAGAAAGTTGGATTTTGAG
GAGTTTTCTGCTGCTGCCATCAGTGTTTACCAGATGGAAGGTTTGGAAACCTGGGAACAA
CATGCCCGGCAAGCGTACGAGTTCTTTGATAAGGAGGGTAACCGACCAATTGTGATCGAC
GAGCTCGCATCGGAACTTGGATTGGGTCCTTCGGTTCCCCTACATGTTGTTCTCCAAGAT
TGGATCAGACATCCTGATGGAAAACTCAGCTTCCTTGGGTTCATGAAACTATTGCATGGA
GTTTCTTCGCGTACCATCCCAAAAACCTGA

Protein

290 aa

>Os03t0366200-01 Similar to Calcium/calmodulin-dependent serine/threonine-protein kinase 1.
IVGSAYYVAPEVLHRSYGTEADMWSIGVIVYILLCGSRPFWARTESGIFRAVLKADPSFE
EAPWPTLSAEAKDFVRRLLNKDYRKRMTAAQALCHPWIRGTEEVKLPLDMIIYRLMRAYI
SSSSLRRAALRALAKTLTTDQIYYLREQFELIGPNKSDLITLQNLKTALMKNSTNAMKDS
RVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQHARQAYEFFDKEGNRPIVID
ELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGVSSRTIPKT*

CDS

chr03:14321293..14321572 (+ strand) : 280 bp

chr03:14321659..14321771 (+ strand) : 113 bp

chr03:14322214..14322321 (+ strand) : 108 bp

chr03:14322393..14322455 (+ strand) : 63 bp

chr03:14322537..14322704 (+ strand) : 168 bp

chr03:14322786..14322923 (+ strand) : 138 bp

3'UTR

chr03:14322924..14323202 (+ strand) : 279 bp

FASTA

>Os03t0366200-01 class=Sequence position=chr03:14321293..14323202 (+ strand)
ATTGTCGGAA GTGCATATTA TGTTGCTCCT GAAGTGCTCC ATCGATCTTA TGGCACTGAG GCAGATATGT GGAGCATTGG
AGTAATAGTG TATATTTTGC TTTGTGGCAG CCGTCCTTTC TGGGCACGTA CTGAGTCAGG AATATTCCGA GCTGTGCTGA
AAGCAGACCC TAGTTTTGAG GAAGCCCCAT GGCCAACCCT CTCTGCTGAA GCAAAAGACT TTGTAAGGAG GCTGCTCAAT
AAAGATTACC GCAAGAGGAT GACTGCTGCA CAAGCCCTCT GTGAGTACCA TAATTATCTT CAGTTTACAC TGTACTACCA
GTCAACTTTG CAGATGATGA ATGCTTTTTT GTTCTACACA TTTAAGGTCA TCCATGGATT CGTGGTACTG AAGAAGTGAA
GCTTCCTTTG GACATGATAA TTTATAGGCT TATGAGGGCT TACATAAGTT CATCTTCTTT ACGGAGAGCT GCATTGAGGG
TAATATTTCT TTTAGGGTGT ATTGGTTTGC CCTTTACTAA TGATATTTAT CTTTATTGCC CCAAATTAAT GTGGAACAAT
GTCATTTATA TAAATTATGC TGCATCGCTT TTTAGAGGGT AATTTAGTGG TAAAATCAAC TTTGCATAGC AAATGACGTT
GTTTTAATGT TCTTATCATT CTTTCTTCAG AATAGTATGT ATCGCTAACC ATGTGTAGAG CATTATTGCA CTTTGCCCAT
TATTTTGTCA TATATCGTGC AAATCTGATT GAATGAGTAA TATAATAAGG TGATCTTAGA AAAATCCTAA GGATGCTATA
TTTTCTCCCA TATTATGATC TCACATTTCC TGTGTGCATT TACCATGGAA TATCTTGTTG CTGATAATAG TGCTGTGCTC
ACTTTAAAAA CTACTACTAA GTAGCTGTTT GTGTTCTGCA GGCCCTTGCC AAGACATTGA CAACAGATCA AATCTATTAC
CTAAGAGAAC AGTTTGAATT GATAGGCCCA AACAAGAGCG ATCTTATTAC TTTGCAAAAT TTGAAGACGG TGAGTTATTT
TACCATTTAG ACTAAATAAC TAGTCTGCTA TGAGATTGCT AAAGTACGCT AAACCTCCAG GCCTTGATGA AGAACTCCAC
AAATGCAATG AAGGATTCTA GGGTGGTTGA CTTTGTTAAC ACAGTAAGCC TAAAGTCCTT TTCTCTCTAC TTTTCAAAGT
AGCACCTGCA GTTGTGTAAT CACTTACCCT ATCAATGATG CCAGATATCC AATATTCAGT ACAGAAAGTT GGATTTTGAG
GAGTTTTCTG CTGCTGCCAT CAGTGTTTAC CAGATGGAAG GTTTGGAAAC CTGGGAACAA CATGCCCGGC AAGCGTACGA
GTTCTTTGAT AAGGAGGGTA ACCGACCAAT TGTGATCGAC GAGCTCGCAT CGGTATATGA TCCCTAACAC TAAATTAGCT
TGGGGTTGGG CACGATGAAA TGTTTCTCAC AGGTGATGAC ATACTATTTT CAGGAACTTG GATTGGGTCC TTCGGTTCCC
CTACATGTTG TTCTCCAAGA TTGGATCAGA CATCCTGATG GAAAACTCAG CTTCCTTGGG TTCATGAAAC TATTGCATGG
AGTTTCTTCG CGTACCATCC CAAAAACCTG AGATAATAAC TTATTTTCTT ACATCAACCA AGGCAAAAGT GTGATGACTA
AACTAATCTC TGGCTGTCTG GAGAAGCGGC ATGGAACCAG TACAAAGATT AACAAAGCTG TCCTAGTGTA ACAAGTGAAA
AAGCTCTCCT GTCAGGCCCG CGAATTTCGC CTTCTCTTAC CAGATGATTG ATGTTGTGTT TGTATTCAGG TTTGTTTAGA
GGTGAATGTA CAGATGAGTT TAGGAAACAG GAAAAATGAG GTGCTAAGAA AGTGAAACAT GGTTTAATTT 

Locus: Os03g0366200

Loading...

Locus: Os03g0366200

Loading...