Os03t0386700-00

Locus

Os03g0386700

Description

Similar to serine carboxypeptidase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SCP12

CGSNL Gene Name

SERINE CARBOXYPEPTIDASE 12

Oryzabase Gene Symbol Synonym(s)

OsSCP12

Oryzabase Gene Name Synonym(s)

Serine carboxypeptidase 12

Transcript Evidence

EU957248 (DDBJ)

Protein Evidence

NP_001148004.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Peptidase S10, serine carboxypeptidase (IPR001563)

Peptidase S10, serine carboxypeptidase, active site (IPR018202)

Expression Databases

TENOR (Os03t0386700-00)

Others

Oryzabase (19195)

KEGG (Os03t0386700-00 (EC:3.4.16.6))

Transcript

1608 bp

>Os03t0386700-00 Similar to serine carboxypeptidase.
GAAGTTCTTGTCACACTAGGTGTTCCTCCTCTATCCTTCCACATGAGCAAAGAAGCGTTC
ACACTCTGGCTGTTCTTCCTGTTGCTTGTACATGGCGCCTTCGCTGATCAGGCTGCTCGA
GTCCTGGAGTTCTCCAGGTCCAGAATGGAGATGCGGGACGACCAATATACGACGGAGCAC
ACGAGTCAACGTGCCAATCATCAGCTGTACATGAGCTCTCAAGATGGACTCAAGGAGGCA
GACAAGGTCAGTGAGCTCCCTGGGCAGCCAGGCAGAGCTGGCTTTGATCAGTATGCAGGA
TATGTCACGGTTAATGCCACATCCGGGAAGGCCCTCTTTTACTACTTTGCAGAGGCTACT
GACGATCCTTCCACTAAGCCTTTGGTCTTGTGGCTGAATGGAGGGCCTGGATGTTCTTCT
CTGGGAGATGGAGCTATGCTTGAAATTGGACCATTCTTAGTCAATGGCGATAACAGGACA
CTGTCCATAAACAGATATGCATGGAACAATGTGGCAAACATGCTCTTCCTTGAGAGCCCA
GCTGGTGTTGGCTTCTCATACTCCAACACAACATCAGACTACGACAACACTGGTGACACG
AGCACGGCAGCAGATGCATACACTTTCCTCACCAACTGGCTCGAGAGGTTCCCAGAGTAC
AAGGGCCGCGACTTCTTCATAACAGGTGAAAGTTACGGCGGCCACTACATACCACAGCTT
GCGAATGCTATATTGTCGAACAACAATATCACAAATGTCACCATCATCAATTTGAAAGGA
GTTGCAATTGGGAATGCATACTTGGATGATAGCACAAACACAAGAGCAACAATTGATTAC
TACTGGACACATGCTTTGATCTCCAAAGAAACTCACCTTGCAGTTCAGCGAAATTGCAGC
TTCAATGGAACATACATGGCACAATGCCGAAATGCTTTAGCAGAAGCTGATACTGAAAAG
GGAGTCATTGATCCATACAACATCTATGCACCCTTATGCTGGAACGCTTCCAATCCCCGA
CAGCTGCACGGCTCGGCAATCAATGTTGACCCCTGTAGCAGATACTACGTCGAATCATAT
CTGAATCGCCCCGAGGTTCAGAGAACACTTCATGCTAACACCACAGGATTAAAACAGCCA
TGGTCAGGTTGCAGTAATATCATCACTCCTGAAAATTGGAAAGATGCACCTGTGTCTATG
TTACCATCTATCCAAGGATTGATTTCAAGTGGAGTAAGTACATGGCTGTACAGTGGTGAT
ATCGATGCGGTGTGCCCAGTAACTTCAACATTGTACTCATTAGACATTCTAGAACTACCA
ATAAACTCATCTTGGCGACCATGGTACTCCGATGACAATGAGGTTGCTGGCTATGTTGTT
GGATACAAAGGTCTGGTATTCGCAACAGTCAGAGAATCTGGACATATGGTTCCTACCTAC
CAACCTCAAAGAGCACTCACCTTGTTCTCCTCGTTCCTGCAAGGGATATTACCCCCTGAA
TGACCATAACTTTGAAAGCTCTGTTTCTTTTTTAATTTTTGGTTTGTTTCTTACAGTGAA
AGATAGAACAGTTTGTCTGGGAAAAATAACTGGAACACAGTAACTAGT

CDS

1503 bp

>Os03t0386700-00 Similar to serine carboxypeptidase.
GAAGTTCTTGTCACACTAGGTGTTCCTCCTCTATCCTTCCACATGAGCAAAGAAGCGTTC
ACACTCTGGCTGTTCTTCCTGTTGCTTGTACATGGCGCCTTCGCTGATCAGGCTGCTCGA
GTCCTGGAGTTCTCCAGGTCCAGAATGGAGATGCGGGACGACCAATATACGACGGAGCAC
ACGAGTCAACGTGCCAATCATCAGCTGTACATGAGCTCTCAAGATGGACTCAAGGAGGCA
GACAAGGTCAGTGAGCTCCCTGGGCAGCCAGGCAGAGCTGGCTTTGATCAGTATGCAGGA
TATGTCACGGTTAATGCCACATCCGGGAAGGCCCTCTTTTACTACTTTGCAGAGGCTACT
GACGATCCTTCCACTAAGCCTTTGGTCTTGTGGCTGAATGGAGGGCCTGGATGTTCTTCT
CTGGGAGATGGAGCTATGCTTGAAATTGGACCATTCTTAGTCAATGGCGATAACAGGACA
CTGTCCATAAACAGATATGCATGGAACAATGTGGCAAACATGCTCTTCCTTGAGAGCCCA
GCTGGTGTTGGCTTCTCATACTCCAACACAACATCAGACTACGACAACACTGGTGACACG
AGCACGGCAGCAGATGCATACACTTTCCTCACCAACTGGCTCGAGAGGTTCCCAGAGTAC
AAGGGCCGCGACTTCTTCATAACAGGTGAAAGTTACGGCGGCCACTACATACCACAGCTT
GCGAATGCTATATTGTCGAACAACAATATCACAAATGTCACCATCATCAATTTGAAAGGA
GTTGCAATTGGGAATGCATACTTGGATGATAGCACAAACACAAGAGCAACAATTGATTAC
TACTGGACACATGCTTTGATCTCCAAAGAAACTCACCTTGCAGTTCAGCGAAATTGCAGC
TTCAATGGAACATACATGGCACAATGCCGAAATGCTTTAGCAGAAGCTGATACTGAAAAG
GGAGTCATTGATCCATACAACATCTATGCACCCTTATGCTGGAACGCTTCCAATCCCCGA
CAGCTGCACGGCTCGGCAATCAATGTTGACCCCTGTAGCAGATACTACGTCGAATCATAT
CTGAATCGCCCCGAGGTTCAGAGAACACTTCATGCTAACACCACAGGATTAAAACAGCCA
TGGTCAGGTTGCAGTAATATCATCACTCCTGAAAATTGGAAAGATGCACCTGTGTCTATG
TTACCATCTATCCAAGGATTGATTTCAAGTGGAGTAAGTACATGGCTGTACAGTGGTGAT
ATCGATGCGGTGTGCCCAGTAACTTCAACATTGTACTCATTAGACATTCTAGAACTACCA
ATAAACTCATCTTGGCGACCATGGTACTCCGATGACAATGAGGTTGCTGGCTATGTTGTT
GGATACAAAGGTCTGGTATTCGCAACAGTCAGAGAATCTGGACATATGGTTCCTACCTAC
CAACCTCAAAGAGCACTCACCTTGTTCTCCTCGTTCCTGCAAGGGATATTACCCCCTGAA
TGA

Protein

501 aa

>Os03t0386700-00 Similar to serine carboxypeptidase.
EVLVTLGVPPLSFHMSKEAFTLWLFFLLLVHGAFADQAARVLEFSRSRMEMRDDQYTTEH
TSQRANHQLYMSSQDGLKEADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEAT
DDPSTKPLVLWLNGGPGCSSLGDGAMLEIGPFLVNGDNRTLSINRYAWNNVANMLFLESP
AGVGFSYSNTTSDYDNTGDTSTAADAYTFLTNWLERFPEYKGRDFFITGESYGGHYIPQL
ANAILSNNNITNVTIINLKGVAIGNAYLDDSTNTRATIDYYWTHALISKETHLAVQRNCS
FNGTYMAQCRNALAEADTEKGVIDPYNIYAPLCWNASNPRQLHGSAINVDPCSRYYVESY
LNRPEVQRTLHANTTGLKQPWSGCSNIITPENWKDAPVSMLPSIQGLISSGVSTWLYSGD
IDAVCPVTSTLYSLDILELPINSSWRPWYSDDNEVAGYVVGYKGLVFATVRESGHMVPTY
QPQRALTLFSSFLQGILPPE*

CDS

chr03:15395285..15395687 (+ strand) : 403 bp

chr03:15396058..15396165 (+ strand) : 108 bp

chr03:15396266..15396540 (+ strand) : 275 bp

chr03:15396628..15396876 (+ strand) : 249 bp

chr03:15396952..15397070 (+ strand) : 119 bp

chr03:15397156..15397254 (+ strand) : 99 bp

chr03:15397350..15397458 (+ strand) : 109 bp

chr03:15397563..15397703 (+ strand) : 141 bp

3'UTR

chr03:15397704..15397808 (+ strand) : 105 bp

FASTA

>Os03t0386700-00 class=Sequence position=chr03:15395285..15397808 (+ strand)
GAAGTTCTTG TCACACTAGG TGTTCCTCCT CTATCCTTCC ACATGAGCAA AGAAGCGTTC ACACTCTGGC TGTTCTTCCT
GTTGCTTGTA CATGGCGCCT TCGCTGATCA GGCTGCTCGA GTCCTGGAGT TCTCCAGGTC CAGAATGGAG ATGCGGGACG
ACCAATATAC GACGGAGCAC ACGAGTCAAC GTGCCAATCA TCAGCTGTAC ATGAGCTCTC AAGATGGACT CAAGGAGGCA
GACAAGGTCA GTGAGCTCCC TGGGCAGCCA GGCAGAGCTG GCTTTGATCA GTATGCAGGA TATGTCACGG TTAATGCCAC
ATCCGGGAAG GCCCTCTTTT ACTACTTTGC AGAGGCTACT GACGATCCTT CCACTAAGCC TTTGGTCTTG TGGCTGAATG
GAGGTACCCC TACATGACTG ATTGATATGC ATTTTAGTGT ACCTTTCTGT GATTCTGTCA GATGAAATGG GTGGCTTTCT
ATTATCTGAT TGTGTTATCC GTTGCTTTCT GCTGTCTGAA TTTTGTATGG TGTTGCAGTA TGCCTGAAAG GTGTTGTTTC
CTAACCATCC ATCAAAAGCA TACTTTGCAT CCATCCAATC ATGCTTCCAA AGTTCAAAAT TCTGTGAAGT TCACAGTTTA
CGAGCCTGTT GACTATTTCT CAAACTATTC TAATCATCTA ATAGTATAGA ATCTACTGTA GAAGATATAT GCTCCTGAAT
AGGATTAACA TGTGAATTCT ATCGTATGAC AAAGTTGTAC CTTGAGATTT CAGGGCCTGG ATGTTCTTCT CTGGGAGATG
GAGCTATGCT TGAAATTGGA CCATTCTTAG TCAATGGCGA TAACAGGACA CTGTCCATAA ACAGATATGC ATGGAACAAT
GGTAAGCAAA CCACCACAAA TGTATAGGAT CAAATTATAC TCACCACGAA AAATCATAAT ACCTTCGCAC AGTTGCACTA
ATGATCGTTC TTGGATGGCA GTGGCAAACA TGCTCTTCCT TGAGAGCCCA GCTGGTGTTG GCTTCTCATA CTCCAACACA
ACATCAGACT ACGACAACAC TGGTGACACG AGCACGGCAG CAGATGCATA CACTTTCCTC ACCAACTGGC TCGAGAGGTT
CCCAGAGTAC AAGGGCCGCG ACTTCTTCAT AACAGGTGAA AGTTACGGCG GCCACTACAT ACCACAGCTT GCGAATGCTA
TATTGTCGAA CAACAATATC ACAAATGTCA CCATCATCAA TTTGAAAGGA GTTGCAGTAA GTTTCAGACA ATGACAATTA
GCAATCCTTA TAATAATATC AGGCCATATA TACTGAATTC TACCTTCGTC TTGTTGGGAA CAGATTGGGA ATGCATACTT
GGATGATAGC ACAAACACAA GAGCAACAAT TGATTACTAC TGGACACATG CTTTGATCTC CAAAGAAACT CACCTTGCAG
TTCAGCGAAA TTGCAGCTTC AATGGAACAT ACATGGCACA ATGCCGAAAT GCTTTAGCAG AAGCTGATAC TGAAAAGGGA
GTCATTGATC CATACAACAT CTATGCACCC TTATGCTGGA ACGCTTCCAA TCCCCGACAG CTGCACGGCT CGGTAATTAA
AATTGTTGTC ACAGATTTTA TCATCTTTCC CGAGCTGCTT TTCCCATCTC ATCAGATGGT TTTGCAGGCA ATCAATGTTG
ACCCCTGTAG CAGATACTAC GTCGAATCAT ATCTGAATCG CCCCGAGGTT CAGAGAACAC TTCATGCTAA CACCACAGGA
TTAAAACAGC CATGGTCAGG TTGCAGGTGC AAGAATAGAA CCAAAAGTCT TTTTGAGTAT TTCATACTAA ACTTTAGGGT
TCTAACCAAG TTTCATATGC TTTCTGACCA GTAATATCAT CACTCCTGAA AATTGGAAAG ATGCACCTGT GTCTATGTTA
CCATCTATCC AAGGATTGAT TTCAAGTGGA GTAAGTACAT GGCTGTACAG GTGAGTCATC GAACATTTTC CTAAAACTTT
ACTTGAACTC AGTCTGTTTT GAATTTATCA CCCTGCTAAG AAATGTTCAT TTTTACCTTT TCCAGTGGTG ATATCGATGC
GGTGTGCCCA GTAACTTCAA CATTGTACTC ATTAGACATT CTAGAACTAC CAATAAACTC ATCTTGGCGA CCATGGTACT
CCGATGACAA TGAGGTATAA AGTTTTGAAT TAGGAATAGA AGCACTAAAG GATGAAGTCT AAACATTAAT TTGCATGTAG
GGTTCTGAAA CTGGTTTTGT TTCTTGGGGA GATTGCAGGT TGCTGGCTAT GTTGTTGGAT ACAAAGGTCT GGTATTCGCA
ACAGTCAGAG AATCTGGACA TATGGTTCCT ACCTACCAAC CTCAAAGAGC ACTCACCTTG TTCTCCTCGT TCCTGCAAGG
GATATTACCC CCTGAATGAC CATAACTTTG AAAGCTCTGT TTCTTTTTTA ATTTTTGGTT TGTTTCTTAC AGTGAAAGAT
AGAACAGTTT GTCTGGGAAA AATAACTGGA ACACAGTAAC TAGT