Os03t0389000-00

Locus

Os03g0389000

Description

Similar to LOL3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMC3, MC3, OsSTA102

Oryzabase Gene Name Synonym(s)

Metacaspase 3

Transcript Evidence

EU956415 (DDBJ)

Protein Evidence

NP_001050268.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: cysteine-type endopeptidase activity (GO:0004197)

Functional domain (InterPro)

Peptidase C14, caspase catalytic (IPR011600)

Expression Databases

TENOR (Os03t0389000-00)

Others

Oryzabase (18156)

KEGG (Os03t0389000-00)

Transcript

1275 bp

>Os03t0389000-00 Similar to LOL3.
atgggctgcaactgcctcgtcggcaagggcggcaacacgaggccagccgccacgacgagc
gcgcggccgtcgtcgtcgcggtgcgcgcactgcggcgcgggcctcgccgtgccgcggccg
gggccggggggcgctgccgccgtcaccaccgtccggtgcgcgctctgccaccgcatgacg
tgcgtcgaccggcgcggcggccgcgacctgggcggcggcggcggtggcggcgcgctcgag
gcctcgtcgtcgtcgtgggcgccggcggaggcgtcgttcctcaggcgagacgcgccgtcc
ggctacccgttcgtccccgggaggaagcgcgcgctcctcgtcggcgtcagctacaagggc
tccagctacgagctcgaggggaccgtcaacgacgtcgactgcatgaggcgcctcctcggc
gagagcttcggtttccccgccgattccatcctcgtgctcaccgctgggcgagggcgaccc
gtcgaggtcgccgacgagggcgaacctgctggcggcgatgcggtggctggtggaagggtg
cgacgccggcgactcgctggtgttccacttctccggccacggcgtgcagaagctggacgt
gaacggcgacgaggtggacggctacaacgaggcgctctgccccgtggacttcgagcggag
cggcaagatcctcgacgacgagatcaacgagaccatcgtccggcccctcgtcgccggcgc
gaagctccacgccatcgtggacacgtgccacagcggcaccatcctggacctccccttcct
ctgccgccTCTCCCGGACGGGCTACTGGCAGTGGGAGAACCACTGCCGCCGCCCGGAGCT
CGCCAAGGGCACCAGCggcggcctcgccatctccatcagcggctgcagcgacgatcagaa
atccgcagacagcagcgcggcggcggcggcggcgatcggggcgatgacgtacagcttcat
cagggcggtggagtcggagcccgggacgacgtacgggcggctgctggcggcgatgcgggc
gacgatccgggaggggcagcaggggagcagcgtccggcggctcctccccggccgcctcgg
ctccttcgtccgcaagatgatcccgtccggcggcgtgcaggagccgcagctttgcgcgtc
ggaggtgttcgacatctacaggaaaccgtttctcctgtgacAAAGCGGTTTTCTCTTTTC
CCGCCACGGATTCGGTTTTACCGCGCGCTGAACCTCTCTGCTTTCATTCATCTGCCTGCC
TCTGAAATTCTCTGA

CDS

1275 bp

>Os03t0389000-00 Similar to LOL3.
atgggctgcaactgcctcgtcggcaagggcggcaacacgaggccagccgccacgacgagc
gcgcggccgtcgtcgtcgcggtgcgcgcactgcggcgcgggcctcgccgtgccgcggccg
gggccggggggcgctgccgccgtcaccaccgtccggtgcgcgctctgccaccgcatgacg
tgcgtcgaccggcgcggcggccgcgacctgggcggcggcggcggtggcggcgcgctcgag
gcctcgtcgtcgtcgtgggcgccggcggaggcgtcgttcctcaggcgagacgcgccgtcc
ggctacccgttcgtccccgggaggaagcgcgcgctcctcgtcggcgtcagctacaagggc
tccagctacgagctcgaggggaccgtcaacgacgtcgactgcatgaggcgcctcctcggc
gagagcttcggtttccccgccgattccatcctcgtgctcaccgctgggcgagggcgaccc
gtcgaggtcgccgacgagggcgaacctgctggcggcgatgcggtggctggtggaagggtg
cgacgccggcgactcgctggtgttccacttctccggccacggcgtgcagaagctggacgt
gaacggcgacgaggtggacggctacaacgaggcgctctgccccgtggacttcgagcggag
cggcaagatcctcgacgacgagatcaacgagaccatcgtccggcccctcgtcgccggcgc
gaagctccacgccatcgtggacacgtgccacagcggcaccatcctggacctccccttcct
ctgccgccTCTCCCGGACGGGCTACTGGCAGTGGGAGAACCACTGCCGCCGCCCGGAGCT
CGCCAAGGGCACCAGCggcggcctcgccatctccatcagcggctgcagcgacgatcagaa
atccgcagacagcagcgcggcggcggcggcggcgatcggggcgatgacgtacagcttcat
cagggcggtggagtcggagcccgggacgacgtacgggcggctgctggcggcgatgcgggc
gacgatccgggaggggcagcaggggagcagcgtccggcggctcctccccggccgcctcgg
ctccttcgtccgcaagatgatcccgtccggcggcgtgcaggagccgcagctttgcgcgtc
ggaggtgttcgacatctacaggaaaccgtttctcctgtgacAAAGCGGTTTTCTCTTTTC
CCGCCACGGATTCGGTTTTACCGCGCGCTGAACCTCTCTGCTTTCATTCATCTGCCTGCC
TCTGAAATTCTCTGA

Protein

425 aa

>Os03t0389000-00 Similar to LOL3.
MGCNCLVGKGGNTRPAATTSARPSSSRCAHCGAGLAVPRPGPGGAAAVTTVRCALCHRMT
CVDRRGGRDLGGGGGGGALEASSSSWAPAEASFLRRDAPSGYPFVPGRKRALLVGVSYKG
SSYELEGTVNDVDCMRRLLGESFGFPADSILVLTAGRGRPVEVADEGEPAGGDAVAGGRV
RRRRLAGVPLLRPRRAEAGRERRRGGRLQRGALPRGLRAERQDPRRRDQRDHRPAPRRRR
EAPRHRGHVPQRHHPGPPLPLPPLPDGLLAVGEPLPPPGARQGHQRRPRHLHQRLQRRSE
IRRQQRGGGGGDRGDDVQLHQGGGVGARDDVRAAAGGDAGDDPGGAAGEQRPAAPPRPPR
LLRPQDDPVRRRAGAAALRVGGVRHLQETVSPVTKRFSLFPPRIRFYRALNLSAFIHLPA
SEIL*

CDS

chr03:15564465..15564927 (- strand) : 463 bp

chr03:15563927..15564379 (- strand) : 453 bp

chr03:15563627..15563830 (- strand) : 204 bp

chr03:15563374..15563528 (- strand) : 155 bp

FASTA

>Os03t0389000-00 class=Sequence position=chr03:15563374..15564927 (- strand)
atgggctgca actgcctcgt cggcaagggc ggcaacacga ggccagccgc cacgacgagc gcgcggccgt cgtcgtcgcg
gtgcgcgcac tgcggcgcgg gcctcgccgt gccgcggccg gggccggggg gcgctgccgc cgtcaccacc gtccggtgcg
cgctctgcca ccgcatgacg tgcgtcgacc ggcgcggcgg ccgcgacctg ggcggcggcg gcggtggcgg cgcgctcgag
gcctcgtcgt cgtcgtgggc gccggcggag gcgtcgttcc tcaggcgaga cgcgccgtcc ggctacccgt tcgtccccgg
gaggaagcgc gcgctcctcg tcggcgtcag ctacaagggc tccagctacg agctcgaggg gaccgtcaac gacgtcgact
gcatgaggcg cctcctcggc gagagcttcg gtttccccgc cgattccatc ctcgtgctca ccggtaatca cccaaaagaa
attttctcca agaagcgatc gagctttcca ctgattagcg acgccgttct cttgatctct cagaggagct gggcgagggc
gacccgtcga ggtcgccgac gagggcgaac ctgctggcgg cgatgcggtg gctggtggaa gggtgcgacg ccggcgactc
gctggtgttc cacttctccg gccacggcgt gcagaagctg gacgtgaacg gcgacgaggt ggacggctac aacgaggcgc
tctgccccgt ggacttcgag cggagcggca agatcctcga cgacgagatc aacgagacca tcgtccggcc cctcgtcgcc
ggcgcgaagc tccacgccat cgtggacacg tgccacagcg gcaccatcct ggacctcccc ttcctctgcc gccTCTCCCG
GACGGGCTAC TGGCAGTGGG AGAACCACTG CCGCCGCCCG GAGCTCGCCA AGGGCACCAG Cggcggcctc gccatctcca
tcagcggctg cagcgacgat cagaaatccg cagacagcag cgtacgccat CGCCATGCAT GACGCCCTTG TCATCCGCGG
AACTCCGTTT CATCTTGTTG GAAACATTCT TGATTTCAGG GATTCTCGTC GGagcaggcg gcggcggcgg cggcgatcgg
ggcgatgacg tacagcttca tcagggcggt ggagtcggag cccgggacga cgtacgggcg gctgctggcg gcgatgcggg
cgacgatccg ggaggggcag caggggagca gcgtccggcg gctcctcccc ggccgcctcg gctccttcgt ccgcaagatg
atcccgtccg gcggcgtgca ggtgagagaT TACGAACTCT GAATCCCTTG ATCCACATCA TCAACCATGG AATTGCTTAA
TTTGCATTAT TGACGCCATT GATCATGCGt gcgttgcagg agccgcagct ttgcgcgtcg gaggtgttcg acatctacag
gaaaccgttt ctcctgtgac AAAGCGGTTT TCTCTTTTCC CGCCACGGAT TCGGTTTTAC CGCGCGCTGA ACCTCTCTGC
TTTCATTCAT CTGCCTGCCT CTGAAATTCT CTGA