Os03t0390200-02

Locus

Os03g0390200

Description

Serine/threonine-protein kinase SAPK1 (EC 2.7.1.37) (Osmotic stress/abscisic acid-activated protein kinase 1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SAPK1

CGSNL Gene Name

STRESS/ABA-ACTIVATED PROTEIN KINASE 1

Oryzabase Gene Symbol Synonym(s)

OsSAPK1

Oryzabase Gene Name Synonym(s)

stress/ABA-activated protein kinase 1, Stress-Activated Protein Kinase 1

Transcript Evidence

AK060856 (DDBJ, Best hit)

Protein Evidence

Q75LR7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

001-034-F03 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0390200-02)

RiceXPro (AK060856)

Others

Oryzabase (9809)

KEGG (Os03t0390200-02 (EC:2.7.1.37, EC:2.7.11.1))

Transcript

1389 bp

>Os03t0390200-02 Serine/threonine-protein kinase SAPK1 (EC 2.7.1.37) (Osmotic stress/abscisic acid-activated protein kinase 1).
ACGAGCGCCCCAGAATCCCTCCCCTCCCTCGTGCACCGCCTCCCGTCCCATCCAGCTCCT
TCTTCTTGGCGGGCGAGAGATCGATCGAGCTGGCTGCGTGTGAGCGAGTTGCCACGAGCG
GCCAAGAGATTAACGGAGGGGGCGGACCAGCGGAGCGAGGTCGTTGAGGGGATATGGAGC
GGTACGAGGTGATGAGGGACATCGGGTCCGGGAACTTCGGGGTGGCCAAGCTCGTCCGCG
ACGTCGCCACCAACCACCTCTTCGCCGTCAAGTTCATCGAGAGGGGACTCAAGATTGATG
AACATGTTCAAAGGGAGATTATGAACCACCGATCACTGAAGCATCCAAACATAATCCGGT
TCAAGGAGGTCGTGCTAACTCCCACACATTTGGCAATAGTTATGGAATATGCTGCTGGTG
GTGAGCTATTTGAAAGGATTTGCAACGCAGGGAGATTCAGTGAGGATGAGGCAAGGTTCT
TCTTCCAACAGCTGATTTCTGGAGTGAGCTATTGTCATTCTATGCAAGTATGCCATAGAG
ATTTGAAACTCGAAAATACTCTCTTGGATGGCAGTGTCACACCTCGGCTTAAGATTTGTG
ATTTTGGTTACTCCAAGTCTTCTGTCCTGCACTCTCAACCGAAATCAACTGTTGGCACAC
CGGCTTACATTGCTCCAGAGGTCCTCTCTAGAAAGGAATACGATGGAAAGGTAGCTGATG
TTTGGTCATGTGGGGTAACACTCTATGTGATGCTTGTTGGTGCGTATCCTTTTGAGGACC
CTGATGACCCAAGGAACTTCCGCAAGACGATCACTAGGATACTCAGTGTACAGTATTCAA
TTCCAGACTACGTTCGAGTTTCAGCGGACTGCAGACATCTCCTGTCCCGGATTTTCGTTG
GAAATCCTGAGCAGAGGATAACTATCCCAGAGATCAAGAACCACCCATGGTTCCTGAAGA
ACCTGCCCATCGAGATGACCGACGAGTACCAGAGGAGCATGCAGCTGGCGGACATGAACA
CGCCGTCGCAGAGCCTGGAGGAGGTCATGGCGATCATTCAGGAGGCCCGGAAACCGGGCG
ACGCCATGAAGCTCGCCGGCGCCGGGCAGGTCGCCTGCCTGGGGAGCATGGATCTCGACG
ACATCGACGATATCGACGACATTGACATCGAGAACAGCGGGGACTTCGTGTGCGCCTTGT
GATCGATAGATGCCAAATTCGATCGATCGATCATCAGCTGGTTGAAGACTGAAGTAGCGG
GGCAGCGAGCTTTCTTTGTGGCTGATGTGTTGCTGTCATTCATGCCTCGTTTTTACTTCT
GGGATCACATATGCTTTGTGACCAAGAGATTGCCATCGCTGTGGATAAATAAGATGAATT
TAATTGCAT

CDS

1029 bp

>Os03t0390200-02 Serine/threonine-protein kinase SAPK1 (EC 2.7.1.37) (Osmotic stress/abscisic acid-activated protein kinase 1).
ATGGAGCGGTACGAGGTGATGAGGGACATCGGGTCCGGGAACTTCGGGGTGGCCAAGCTC
GTCCGCGACGTCGCCACCAACCACCTCTTCGCCGTCAAGTTCATCGAGAGGGGACTCAAG
ATTGATGAACATGTTCAAAGGGAGATTATGAACCACCGATCACTGAAGCATCCAAACATA
ATCCGGTTCAAGGAGGTCGTGCTAACTCCCACACATTTGGCAATAGTTATGGAATATGCT
GCTGGTGGTGAGCTATTTGAAAGGATTTGCAACGCAGGGAGATTCAGTGAGGATGAGGCA
AGGTTCTTCTTCCAACAGCTGATTTCTGGAGTGAGCTATTGTCATTCTATGCAAGTATGC
CATAGAGATTTGAAACTCGAAAATACTCTCTTGGATGGCAGTGTCACACCTCGGCTTAAG
ATTTGTGATTTTGGTTACTCCAAGTCTTCTGTCCTGCACTCTCAACCGAAATCAACTGTT
GGCACACCGGCTTACATTGCTCCAGAGGTCCTCTCTAGAAAGGAATACGATGGAAAGGTA
GCTGATGTTTGGTCATGTGGGGTAACACTCTATGTGATGCTTGTTGGTGCGTATCCTTTT
GAGGACCCTGATGACCCAAGGAACTTCCGCAAGACGATCACTAGGATACTCAGTGTACAG
TATTCAATTCCAGACTACGTTCGAGTTTCAGCGGACTGCAGACATCTCCTGTCCCGGATT
TTCGTTGGAAATCCTGAGCAGAGGATAACTATCCCAGAGATCAAGAACCACCCATGGTTC
CTGAAGAACCTGCCCATCGAGATGACCGACGAGTACCAGAGGAGCATGCAGCTGGCGGAC
ATGAACACGCCGTCGCAGAGCCTGGAGGAGGTCATGGCGATCATTCAGGAGGCCCGGAAA
CCGGGCGACGCCATGAAGCTCGCCGGCGCCGGGCAGGTCGCCTGCCTGGGGAGCATGGAT
CTCGACGACATCGACGATATCGACGACATTGACATCGAGAACAGCGGGGACTTCGTGTGC
GCCTTGTGA

Protein

343 aa

>Os03t0390200-02 Serine/threonine-protein kinase SAPK1 (EC 2.7.1.37) (Osmotic stress/abscisic acid-activated protein kinase 1).
MERYEVMRDIGSGNFGVAKLVRDVATNHLFAVKFIERGLKIDEHVQREIMNHRSLKHPNI
IRFKEVVLTPTHLAIVMEYAAGGELFERICNAGRFSEDEARFFFQQLISGVSYCHSMQVC
HRDLKLENTLLDGSVTPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLSRKEYDGKV
ADVWSCGVTLYVMLVGAYPFEDPDDPRNFRKTITRILSVQYSIPDYVRVSADCRHLLSRI
FVGNPEQRITIPEIKNHPWFLKNLPIEMTDEYQRSMQLADMNTPSQSLEEVMAIIQEARK
PGDAMKLAGAGQVACLGSMDLDDIDDIDDIDIENSGDFVCAL*

5'UTR

chr03:15632212..15632384 (- strand) : 173 bp

CDS

chr03:15632092..15632211 (- strand) : 120 bp

chr03:15631041..15631115 (- strand) : 75 bp

chr03:15629872..15629973 (- strand) : 102 bp

chr03:15629735..15629788 (- strand) : 54 bp

chr03:15629558..15629650 (- strand) : 93 bp

chr03:15629358..15629450 (- strand) : 93 bp

chr03:15629150..15629254 (- strand) : 105 bp

chr03:15628948..15629046 (- strand) : 99 bp

chr03:15628537..15628824 (- strand) : 288 bp

3'UTR

chr03:15628350..15628536 (- strand) : 187 bp

FASTA

>Os03t0390200-02 class=Sequence position=chr03:15628350..15632384 (- strand)
ACGAGCGCCC CAGAATCCCT CCCCTCCCTC GTGCACCGCC TCCCGTCCCA TCCAGCTCCT TCTTCTTGGC GGGCGAGAGA
TCGATCGAGC TGGCTGCGTG TGAGCGAGTT GCCACGAGCG GCCAAGAGAT TAACGGAGGG GGCGGACCAG CGGAGCGAGG
TCGTTGAGGG GATATGGAGC GGTACGAGGT GATGAGGGAC ATCGGGTCCG GGAACTTCGG GGTGGCCAAG CTCGTCCGCG
ACGTCGCCAC CAACCACCTC TTCGCCGTCA AGTTCATCGA GAGGGGACTC AAGGTAAAAT GAAAGCTTCA CCCTCCAAAC
TTTTTTCTTT CTTTCTTTCT TTCTTTTTGT TATGGTATGC ACATCGACTG TGCGATCTGT GCTGGCTGTG AGATGTTTGC
TCCGTTCGGC CGGGGCTTGT CTGAATTGCT AGAGCAACGC TGCTTGAAAT GTTTCCTTCA CATTTGGAGT CCTGCAAAAA
TAGCCGAATT TTCAGCATCC GGGAGAATCG GTTAGCGTTA GTTTTGCAGT AGGATTTTAC ATTTGTTCCC CCATCTTTTT
AGTGCAGTTG ATTGGTTGAA GCTTGCGCAT TTCTTTCTAG ATTACTTTTA GTTGTAACTA ATTTGCTTCT AGAGAAGGAA
TATATCCCAA AATGCTGGTA CCTTTTGTTA GGCCAAAAGG AACCCAAGAA AATTGGTCAA TCCCTTTGAC TATATTTGGT
CCCTGACTCT CTAACACCTG ACGAACTCTT ATCGGTGACA TTTGCCTCAA GGAAGCTAGC AGAGCCAAAC TGTTCTACGC
ATAGTGATTT TTTATTTTTA TTTTTTTGGC GTGAAGCACT GGCTATGATG ACATAAGTTT CAATCAATTT TATTACTTAT
GTAGCTTGCT GTCTTTTATA TTCAAATTTG TAGCTGCTTT TGATGGCCTT TTCTAAGCTC ACTTTGGCAT TTGGTGGATG
TTTCTAGCGT TTTCGCTAGC CTTTCATACA TGTCACTCGT CATTTATTAG TTCATTAATT GCTCTACTGT TACTGTGTGC
TATGCTGTCC GTTTCTTGTT CTTCTTCCTC GTTTACTGTC GAGGTGCTGT CCATTACTAT TTCGGGCTGA TGATATTTTT
GTTGTATTTT TTGTTCTGTT CGAGCTGTTT TTTTTGTAAT ATTAATCTCT CTGTAAAAAA AATGGTACTC TAATAAGGGC
CTTTGGTATC CATCATTGAG CGTCTTTGGT TCATTGGTTA ACTCCACTTT TTTTTTTATC GTTGTGTAGA TTGATGAACA
TGTTCAAAGG GAGATTATGA ACCACCGATC ACTGAAGCAT CCAAACATAA TCCGGTTCAA GGAGGTAATC TCTTGGGCCT
CTAGGGAAGT AATGTGTAAT ATAATCTCTA GTTGAATTGA GTGTTATGAT TGTTTCTGCT CTTTTCGGGA ATTTTTTTTT
CTACTGATAG AAAGCGATAG TTATCTGTAT TCTTCCACGC CTCTATGTTT ATAGGAGGAC AGATGGAATA TGTAACGTGA
AAGTTTAGTT GCACATTTAG GAGGACTCTT TTGATGGTGA CTTTTATCGC TTGAATGTCA CTGTTTTCAC CCCTGTTTTG
TTCTTTTTCT GTTTTGAGTT CTCTTTAACT TCGAATATGC TGCTCACTTT AGTGTGTATG ATTTGCATGA ACCTTGTACT
TTGTTTTTTC CACGGGCAGA CTAGTAGGCT AATTGCCTAA TTGCATAGAT TCCTTTTTGA AGGAAAAAAA ATCAGGGCAG
TTTTTTTACA CTCTGCACAA ATGAAAATAG TAGTTATTTC TAAAATAACA AAAATTAGGA GTTATTATTA TAAAAACAAG
TTATTTACAA AAGAAAAGGA GAAGTGCATG AAAGCAAAAG TTGCTAATCT GCTATTTTCA GGGAACTAAA TGTACTAGTG
TCTGGCATTA ATTGTTGAGT CATGTTTTTC AGGTTAACTC TGTCTTACTA CTGTCTGTGT TCTGTGTAAC TCAGGGAAGT
TGATTCTTAT TTAGATTGAC AATGCGTATG TGTCCTTTTA TGCTGCCTTT TACTGTATCG ATGTTGTTAT AAAAAATTCT
TTTGTGGGGA GCACGCAAAA GCTTTGCATG GCATTCCATT AGAGAAGAGA GTTGAATACA ACAAGTTGGC CCAAGGCCCA
AAACAGACCT AGAAAGTCTT AAATTAGGTG CTAAAATTTT CAGGGCTATT TTAGGTTCTT TCGTCATTTT TTCTTCCAAG
ATCTGTTGAA CAGGGTTTTT AGAATAAAGC TATCCTTGTG AATATTGCGA GCACTTTCCG CAGTTCTTTC TCTGCATTCA
TCGCTGAACA CATGTATTTG ACTGTTTGAC GAGGTTTAAC ATTCAAACTT GTATTGAGAG TTGAAAAATT AAAGTAGTCC
TTAGTTTTCA GGTCGTGCTA ACTCCCACAC ATTTGGCAAT AGTTATGGAA TATGCTGCTG GTGGTGAGCT ATTTGAAAGG
ATTTGCAACG CAGGGAGATT CAGTGAGGAT GAGGTAGAGA ATATTCTCCA CAATCTTTGG GACTCTTATG CAGATTTATG
TCATTGCATT GACAAATTAT TCATTATCCT CATCAGGCAA GGTTCTTCTT CCAACAGCTG ATTTCTGGAG TGAGCTATTG
TCATTCTATG GTACATGATG TCTAGTTGAC TTAAAAATAT CAACTCTTTT GTAGACTATT GCCCACATTT GTCCTTATCT
TTTTCTGCTT GCAGCAAGTA TGCCATAGAG ATTTGAAACT CGAAAATACT CTCTTGGATG GCAGTGTCAC ACCTCGGCTT
AAGATTTGTG ATTTTGGTTA CTCCAAGGTA TGATTTATGC AGATACTATC CTCTGACATT CATGTTTTCT GTTGCCTAAA
ATTAGTACCC ACCTGGCCAC CCCTCCCTTT GGGCCTTTCT TTTTTAATTT TCAGTCTTCT GTCCTGCACT CTCAACCGAA
ATCAACTGTT GGCACACCGG CTTACATTGC TCCAGAGGTC CTCTCTAGAA AGGAATACGA TGGAAAGGTA ATTTTGTTCG
CATGATTTGG GATGAGTCTC TCTATGATCC TACCAAATAG TCTTAATTTC CATGACTGGA CTGTTGAAAC ATAATTACTT
CGAATCTTAG GTAGCTGATG TTTGGTCATG TGGGGTAACA CTCTATGTGA TGCTTGTTGG TGCGTATCCT TTTGAGGACC
CTGATGACCC AAGGAACTTC CGCAAGACGA TCACTGTGAG TAAATCCGGC CATTGCCCAT AGCCCCCACT CCTGTTAATT
CAAAATCTGT CTCAATTCTA GTCAGTCTGA TCATGTAGCC TATTGACCTC TTTTGCAGAG GATACTCAGT GTACAGTATT
CAATTCCAGA CTACGTTCGA GTTTCAGCGG ACTGCAGACA TCTCCTGTCC CGGATTTTCG TTGGAAATCC TGAGCAGGTG
ACTCCTCGTC ATGAAATAAT TCACCATTTC ACCTAGTAGC TTAGTGATCA ATCTGCATTG GCTTTCCAAC ATGGTGTCAA
CCGACAAACA TTCGTAAATT GCATGCATTT CTCTTTGTAG AGGATAACTA TCCCAGAGAT CAAGAACCAC CCATGGTTCC
TGAAGAACCT GCCCATCGAG ATGACCGACG AGTACCAGAG GAGCATGCAG CTGGCGGACA TGAACACGCC GTCGCAGAGC
CTGGAGGAGG TCATGGCGAT CATTCAGGAG GCCCGGAAAC CGGGCGACGC CATGAAGCTC GCCGGCGCCG GGCAGGTCGC
CTGCCTGGGG AGCATGGATC TCGACGACAT CGACGATATC GACGACATTG ACATCGAGAA CAGCGGGGAC TTCGTGTGCG
CCTTGTGATC GATAGATGCC AAATTCGATC GATCGATCAT CAGCTGGTTG AAGACTGAAG TAGCGGGGCA GCGAGCTTTC
TTTGTGGCTG ATGTGTTGCT GTCATTCATG CCTCGTTTTT ACTTCTGGGA TCACATATGC TTTGTGACCA AGAGATTGCC
ATCGCTGTGG ATAAATAAGA TGAATTTAAT TGCAT

Locus: Os03g0390200

Loading...

Locus: Os03g0390200

Loading...