Os03t0390600-01

Locus

Os03g0390600

Description

Similar to Histone H3 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

histone H3

Transcript Evidence

AK120198 (DDBJ, Best hit)

Protein Evidence

D7SL91 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: nucleosome assembly (GO:0006334)

Cellular Component: nucleosome (GO:0000786)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Histone H3 (IPR000164)

Histone core (IPR007125)

Histone-fold (IPR009072)

Full-length cDNA

J013036N20 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0390600-01)

Others

Oryzabase (15761)

Transcript

621 bp

>Os03t0390600-01 Similar to Histone H3 (Fragment).
AATTTTTCTGCGGTTTCTTCTTCTTCTTCCTCCTCCTCGCGCTCCCCCGATTCGAAGCGT
GAAGAGAGGAACGGCGCTTGCGAGAGGAGAGAGatggcccgtaccaagcagaccgctcgt
aagtccacaggaggaaaggctcccaggaagcagcttgccaccaagGCTGCTCGTAAGTCT
GCTCCCACCACTGGAGGAGTTAAGAAGCCCCATTCATGCCAAGCGTGTGACCATCATGCC
TAAGGACATTCAGCTGGCTAGGAGGATTCGTGGTGAGAGGGCTTAAATTCCCCTCGGCGA
TTCCTTTGACAAATGAAGCATGCGTCGTAGTGTTAGTAGTGGGTTTTAATCTTTTGCTTA
TAAGAACAATCTGAGTAGGGTGTATTTTGTGGAACAATATGTTTCTCATGATGGTGCTGT
ATTCGTCTTATTGGTGGATCTGTCAAAAATACTCAGCATATTGTCAGTGTGTCTGGTGAC
TCTTATTTTGTTAGTCTGATTCGTTTGCGTCTTATTCTAGCGGTGCTGCCTCTTTGGCAC
TGTGCATGGCTAGATACAATTACATTGTAATTCACCTGTCTCTAATCCGTGTTAATGTAA
GTGTTCCGTTGCTGTCCGTGT

CDS

285 bp

>Os03t0390600-01 Similar to Histone H3 (Fragment).
ATTTTTCTGCGGTTTCTTCTTCTTCTTCCTCCTCCTCGCGCTCCCCCGATTCGAAGCGTG
AAGAGAGGAACGGCGCTTGCGAGAGGAGAGAGatggcccgtaccaagcagaccgctcgta
agtccacaggaggaaaggctcccaggaagcagcttgccaccaagGCTGCTCGTAAGTCTG
CTCCCACCACTGGAGGAGTTAAGAAGCCCCATTCATGCCAAGCGTGTGACCATCATGCCT
AAGGACATTCAGCTGGCTAGGAGGATTCGTGGTGAGAGGGCTTAA

Protein

95 aa

>Os03t0390600-01 Similar to Histone H3 (Fragment).
IFLRFLLLLPPPRAPPIRSVKRGTALARGERWPVPSRPLVSPQEERLPGSSLPPRLLVSL
LPPLEELRSPIHAKRVTIMPKDIQLARRIRGERA*

5'UTR

chr03:15645609..15645609 (+ strand) : 1 bp

CDS

chr03:15645610..15645701 (+ strand) : 92 bp

chr03:15647132..15647203 (+ strand) : 72 bp

chr03:15647289..15647332 (+ strand) : 44 bp

chr03:15647739..15647815 (+ strand) : 77 bp

3'UTR

chr03:15647816..15648150 (+ strand) : 335 bp

FASTA

>Os03t0390600-01 class=Sequence position=chr03:15645609..15648150 (+ strand)
AATTTTTCTG CGGTTTCTTC TTCTTCTTCC TCCTCCTCGC GCTCCCCCGA TTCGAAGCGT GAAGAGAGGA ACGGCGCTTG
CGAGAGGAGA GAGGTAAGCA TCACGGCGAA GTTTCCCCCT CTCTCTTTCT TTTCGTCTCG TTTGCTGCGA CCCCGGCGGG
GTATTGAGAT TCTCCGTTGA GGTCGGTTGG TTGGGGGCTT GGGGGATTGG GTGGGTTAGG GCTTGGGGGT GGGGGGAATT
TGGCGATTTG GGGGGTTTTC TCGGGTGATC TGCTTGTTTT TGCGCCGTTT CGCCCGGTGA ATGCCAGCCC CGTGTGATTT
GCTGGTTTGG TTGTGGTCTA ATCGTCTGAT ATTCCAGGGC TGTGTAGTCC TGTAGTTTTT GACTAGGTAA TTGGAGTGCT
GATGGGATTT GCCGTTGAAT TTTAGGTTGT TTAGCTCTAA TTTACCTGCA ACGTTTTGGG AATTAGGGTT TCTTGGTGAA
TTTTAGGTTG TTTAGCTTTA ATTTACCTGC AACGTTTTGG GAATTAGGGT TTATTGGTGA TATAGTGGAT ACGCATCGTA
AACTTGTATT TAGGATTCCC CTTGGGATTT TGTAGGCGAG TGGCGGCTGT ATGTGATTGG CACGAATTAT TTACTCGGGT
GAATTTAGAC TAGCTATTTT ATTGTTGCCG TGCCCTTTCT GGATATGAAC GGATGAATAT GGCGTCACTG CTCGATGATA
TCGCAATGTT ATGATTGAAA AAGCATAGTA GTTATACTGA TGCCATTGTG TAGTAGTTAG TTTGTACCTC CCCTGGGTTG
CATTGCAACT TGCGTTAATA TGGATACTCC GTACAATTGT TTATTGTTTA CTTGGTATAG CTATGCTGCA TTTTCTATAT
TTGTTGGGTT ATAAGTTTTT GTCCAATATT TTTAATGACT TGTGCCAGAG GCTCTCAATC CTCTGTTATT AGACCTGTAA
TTGTAAGGTC TATTTCTCCT TCATTCTGTT TCAATGTTAG TTTGTGGATG TACAGAAATC AAGCTATGAT TGATATAATA
CATTGCTTTG GCATAATGGC ACTCTTATTT TTGTTTTATT TAGGAGAGTG CTGTGTATTA GTTTGTTCAG TTAATTCAAT
GTTGTATGTT TTACTGTGTC GGGAACTTAC AGATGTTCTC TTTAGGTTTC TATCCATTAG TAAGTAGAGT TGTTGCTTTG
CTTGAAACCA TCAATTTGAA TCTGTTTATA GAGATAGGCT GTTATTCCTG CTTACTATTT TTTATATAGT TACTTTGCCA
TCCGTTAATC AGGTTAAGAA CAATAAATTG TGTCCATAAT CAATGTTTTC AATGGAACTC ACAAAATTTT GACAGAAACA
TGTTGCTTTC TTAGGTCAAT CTCTAGCATA TTGTTTTTTT TTTGAATTGT TACTTGTTTC TGTGGTGTTA TTACAGAAAG
TGCTTACTTC CACTCTAGAA TTTTATTACA TTTTTGTCAC AGCATATTCT GTCTGTAACA TGTTATTCCT TTTTGTAACA
Tagatggccc gtaccaagca gaccgctcgt aagtccacag gaggaaaggc tcccaggaag cagcttgcca ccaaggtatA
ATTCTTTTCA TACTTGCCTT TTGCTTTGTT AAACACAGAG TGATTTCGAC AGATGGTCTT ACATCACCAT CTCTGTGCAG
GCTGCTCGTA AGTCTGCTCC CACCACTGGA GGAGTTAAGA AGCCCCACCG TTACCGCCCT GGAACTGTTG CCCTCCGGTT
AGTATCAAAT TCCTGGGATG GTTACCTCCA TGTGGTCTTT GATATGCTTT TGCTTATTTG TTTTGCTACT ATTGTGCTTA
TAAAACAGTG AGATTCGCAA GTACCAGAAG AGTACTGAGC TTTTGATCAG GAAGCTGCCC TTCCAGAGGC TTGTTAGGGA
AATTGCACAG GACTTCAAGG TTGGTATCTC AAAAGTTCAT GGCATAATTT GATTGCTTTC AAATTTGGAT TGTTTGTGAT
GGCTTATCGA TTGAACTTGG CTTTGTTGTT TTGCAGACCG ATCTGCGTTT CCAGAGCCAT GCTGTCCTTG CCCTCCAGGA
GGCTGCGGAG GCATACCTTG TTGGTCTCTT CGAGGACACC AACCTGTGCG CCATTCATGC CAAGCGTGTG ACCATCATGC
CTAAGGACAT TCAGCTGGCT AGGAGGATTC GTGGTGAGAG GGCTTAAATT CCCCTCGGCG ATTCCTTTGA CAAATGAAGC
ATGCGTCGTA GTGTTAGTAG TGGGTTTTAA TCTTTTGCTT ATAAGAACAA TCTGAGTAGG GTGTATTTTG TGGAACAATA
TGTTTCTCAT GATGGTGCTG TATTCGTCTT ATTGGTGGAT CTGTCAAAAA TACTCAGCAT ATTGTCAGTG TGTCTGGTGA
CTCTTATTTT GTTAGTCTGA TTCGTTTGCG TCTTATTCTA GCGGTGCTGC CTCTTTGGCA CTGTGCATGG CTAGATACAA
TTACATTGTA ATTCACCTGT CTCTAATCCG TGTTAATGTA AGTGTTCCGT TGCTGTCCGT GT