Os03t0391700-01

Locus

Os03g0391700

Description

bHLH transcription factor, Regulation of thermosensitive male sterility

RAP-DB Gene Symbol Synonym(s)

OsbHLH138

RAP-DB Gene Name Synonym(s)

basic helix-loop-helix protein 138

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH138, bHLH138, OsPIF4, PIF4, OsSACL2, SACL2

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 138, Phytochrome-interacting factor 4

Transcript Evidence

AK065674

Protein Evidence

Q75KP4

Literature

PMID: 30778635

Note

Manual Curation

June 8, 2020

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Helix-loop-helix DNA-binding domain superfamily (IPR036638)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J013036B10 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0391700-01)

Others

Oryzabase (15415)

Transcript

2511 bp

>Os03t0391700-01 bHLH transcription factor, Regulation of thermosensitive male sterility
ATTTCCGTCCGAGGGGGCCGATAAGAGAAGCCGCGCCGCGGCGCACGCTCTCGCTGTCTC
TCTCTCTCTCTCTCTCTCTCGTCCTCGTCTCGGTCTCGCCGTGCGGCTCTCTCTCGTGAG
CAACAGCACGCGCCGCGGTCGGCCTCCCCTTCAATTCCTTCGGCTTTGGCCCGGGCGGGT
GTGTGAGTGCTCAGCTCCTATCGCCGATTCGTCGTCCTCCTCCTCCTCATCCTGCTCGAT
CTGGTAATTCTAGTGTTGAGGGTCTGAGGAGCTGAAACTAGCACGGGTACCCTGGCAGCA
TGCGGTGGCTGGCTCTCTCGGTAGACATCTTCCGCAAAGGGATCTCCTTGAACCTGTACT
GCCGGGTTATTCTGTAAATTGCCTCCATTATTGCTCTACTCCAATCCTGATCTTCTAGTC
TCTGAAGTTTGGGATTGAAGATCTGGTTGCTGGCATTGCTGTTTGGGTTTCTGTGGTTGC
CTGGCAATTCTTTCAAGGAGAACGGGCAGGAGTACTAATGGTGTGGCAACCGGTGGCTCA
GACGAGATTCCGCGTGTTTAAACATGAGAATGGAATCGCTGTGAGAGTTATAGCTTGCTT
CCAGCCATCCCAAGATTGCCAGGCCGAGTACTTCCGCCATCTTCTTAAGCCCGTGACGTA
GTTCGACTCCCTCCCTTCCATTTGCTGTTGAATAGAACCTGTGCTGCTCTAAGTTTTTCT
GAAGCAAAAGTAAAGCAGGAGAATTTCCTGTTCATCTCAATTTTCTGGTGATCCTGTTTG
CTGGTTGTTTCTTGATGGGGGAGAAGGTTAATCCCTGGTGCCATTGGTCTAATCCCCCAT
GGACCGAGAGCTCTGCAAACAATCTCCACCCACCCGATGTTAGCCTCGACAACACAAATT
CAGTGGCGTTGCCAACATATCTGAACAGCGATGGCTACATTTATTCTGGAGTTGCTGCAT
CTATGCCGTCTATTGCAGCATCAGTTACTGACAGACCTGTTTCATTCTCTTCTAGATTTG
TCACAACATTGGTACCCAGTGTAGGCTTATCAACAGCTGAGACACTGAGAAAGAGACCTC
TGGTTTTCTTTCATAATGTGAATAATACCTTCACTGTAGGTCCTCTCCTGAGCAAGGGGA
CATTGGATACAGTTCCAGAGCTCCAAGGTAGCAATGAGACCAATGTAACTGATGTTGGAG
CACAAAATACTGAGTGTATGCATGAGAATACTGAGGAGATTGATGCACTCCTGTGTTCCG
ACTCAGATGAAGGGTGCTTGAAAGTGCAAGAACTCAACAACAGAGTCAGGAAATACCCAA
TGCAGAATGACACCATGAGTGTGGAGTCGGTAGCAAGCGCTGGTGCTTCCCAACCAGCAA
AGAAAAGAAGACTAAGCTCTGGTACCGACAGATCTGTGGTTGACACAGCCAGCTCAGCAA
GGCCTGACCACTCCGTTGATCAGAAACATCTCAGCCATGACGACGACGCACAGTCGTGTT
GTATTGGTGAAGTGGAAAGCGATCACCAGTTTGCTCTGAGGGAAGGTGAAGAAGCAGAAG
GTGATGATGGCCCCGATGATCGGAAGCGGAGAAGAGAGAGGATCCAAGAGACTGTTGCTG
CACTCAGAAAGATAGTTCCTGGAGGCATTGCCAAAGATGCCACAGCCGTTCTTGATGAAG
CGATATGCTATCTCAAGTATCTAAAGCTCAAGGTCAAGACACTGGGAGCTGTTTCCCTCT
AGCTCCTCGATCGATGACGGTTCTGTTCTGGTTCCTGAACCCAATACCTATCCCTCTCTC
CATATATACAAGTAATGAGCTAAAACTATAGCAGCAATAAGGTGAAATGAAACTCAGTCA
GTTCCATTCGGTGATTCTGAGGACTACTGGAGTGAAAGCTCAATGGTGCTTTGCTTACAA
GGGTCCAATGATTTGAGTGGTTACAATGAAGATTCAGTATTGCAGTATATTACTAGTGAA
TCACCGACCACTGCACCTTCATCCATCCATCCACTGATGGAGAGTACTACCTAGCAGCAA
GCCGGTGTCACATCTTTCTTCTGGGTCAGTTCAGTGCAGTGCCTCTTGGTAGGCACCTCC
TCCCTCTCATAAAAAAAGGCTCTCATGGCGTTGATGGCGCAATAAGTAAAACAGGGAGGC
TAAGCTATAAAGATCTTTTTTCTCCCCTCCATTGTGGTGTGATCCAAAGCAAAGGAAGGA
AGGAGGAATGAATGAATGAAGTCCATGCAAAGTGCAGTGCTGGTGGCCTGGTGCTGCATG
CGTCGATGGCTTTTTGACCCCCAAAGGTTGAGAGATGAGATGGCGGGGCCGCGCCCGAGG
TTAGTTCGGGCTCCTTGTGTGTGTTTGTATGGTGGCGTGTGTAGCTAGCAGAGTGTGCGT
GATGGCGTCGTCCCTCGCGCTTTTTCTGCCTTTCTACTAGTACTATACATATATGCTACT
GTATACTGTACTCCTATGTATGAATACTGCATGTGTTTGTGTTTGTGTTTG

CDS

948 bp

>Os03t0391700-01 bHLH transcription factor, Regulation of thermosensitive male sterility
ATGGGGGAGAAGGTTAATCCCTGGTGCCATTGGTCTAATCCCCCATGGACCGAGAGCTCT
GCAAACAATCTCCACCCACCCGATGTTAGCCTCGACAACACAAATTCAGTGGCGTTGCCA
ACATATCTGAACAGCGATGGCTACATTTATTCTGGAGTTGCTGCATCTATGCCGTCTATT
GCAGCATCAGTTACTGACAGACCTGTTTCATTCTCTTCTAGATTTGTCACAACATTGGTA
CCCAGTGTAGGCTTATCAACAGCTGAGACACTGAGAAAGAGACCTCTGGTTTTCTTTCAT
AATGTGAATAATACCTTCACTGTAGGTCCTCTCCTGAGCAAGGGGACATTGGATACAGTT
CCAGAGCTCCAAGGTAGCAATGAGACCAATGTAACTGATGTTGGAGCACAAAATACTGAG
TGTATGCATGAGAATACTGAGGAGATTGATGCACTCCTGTGTTCCGACTCAGATGAAGGG
TGCTTGAAAGTGCAAGAACTCAACAACAGAGTCAGGAAATACCCAATGCAGAATGACACC
ATGAGTGTGGAGTCGGTAGCAAGCGCTGGTGCTTCCCAACCAGCAAAGAAAAGAAGACTA
AGCTCTGGTACCGACAGATCTGTGGTTGACACAGCCAGCTCAGCAAGGCCTGACCACTCC
GTTGATCAGAAACATCTCAGCCATGACGACGACGCACAGTCGTGTTGTATTGGTGAAGTG
GAAAGCGATCACCAGTTTGCTCTGAGGGAAGGTGAAGAAGCAGAAGGTGATGATGGCCCC
GATGATCGGAAGCGGAGAAGAGAGAGGATCCAAGAGACTGTTGCTGCACTCAGAAAGATA
GTTCCTGGAGGCATTGCCAAAGATGCCACAGCCGTTCTTGATGAAGCGATATGCTATCTC
AAGTATCTAAAGCTCAAGGTCAAGACACTGGGAGCTGTTTCCCTCTAG

Protein

316 aa

>Os03t0391700-01 bHLH transcription factor, Regulation of thermosensitive male sterility
MGEKVNPWCHWSNPPWTESSANNLHPPDVSLDNTNSVALPTYLNSDGYIYSGVAASMPSI
AASVTDRPVSFSSRFVTTLVPSVGLSTAETLRKRPLVFFHNVNNTFTVGPLLSKGTLDTV
PELQGSNETNVTDVGAQNTECMHENTEEIDALLCSDSDEGCLKVQELNNRVRKYPMQNDT
MSVESVASAGASQPAKKRRLSSGTDRSVVDTASSARPDHSVDQKHLSHDDDAQSCCIGEV
ESDHQFALREGEEAEGDDGPDDRKRRRERIQETVAALRKIVPGGIAKDATAVLDEAICYL
KYLKLKVKTLGAVSL*

5'UTR

chr03:15689003..15689245 (- strand) : 243 bp

chr03:15687658..15688036 (- strand) : 379 bp

chr03:15687425..15687572 (- strand) : 148 bp

chr03:15687306..15687329 (- strand) : 24 bp

CDS

chr03:15686358..15687305 (- strand) : 948 bp

3'UTR

chr03:15685589..15686357 (- strand) : 769 bp

FASTA

>Os03t0391700-01 class=Sequence position=chr03:15685589..15689245 (- strand)
ATTTCCGTCC GAGGGGGCCG ATAAGAGAAG CCGCGCCGCG GCGCACGCTC TCGCTGTCTC TCTCTCTCTC TCTCTCTCTC
GTCCTCGTCT CGGTCTCGCC GTGCGGCTCT CTCTCGTGAG CAACAGCACG CGCCGCGGTC GGCCTCCCCT TCAATTCCTT
CGGCTTTGGC CCGGGCGGGT GTGTGAGTGC TCAGCTCCTA TCGCCGATTC GTCGTCCTCC TCCTCCTCAT CCTGCTCGAT
CTGGTGAGTG CTTGATTTGT TTTTCTTGGT TGGGTGGGGA TGTGGTGCTC TGCTCGATCG ACCCCGTGAT GTTCTTCTCG
TAAAGATTCG TGGGCTAGTT TGGTTCTGAT TCTGTATCGA CGTGTCTCGC GTTGTCTGTC GCTGCGGGTA GAGTTCTTCA
GCCGCTCGGA TACTTTCGGT CTTCTTCCCC ATGGATAAAA GAGGTTTGTG TAGTAAGTGT TAGTGGTATG TATTCTGTGT
ATACTGTAAT AACTGTTGTG TTGTTGAGTC CGGATGGTGT CAAATCGGTT GGTGTTTTTG GAGATTTTAA GATGTTCCTC
GCTAGGTAAA AAAAGAACAA AACAAAGAAA CTGGGGAAGT TTTGTTTCTT GGCTCATACA GGGGATATTT GCATGCTGAA
GTCCGGTCAA ACGACCAAAT TTGCTTCTTC CCTTTTCTCT TTTGGAGGCT CTGCTTCTTC CCTTTTCTGG TTTCCGGAGC
TAGATTTGTG GTTTCTTGTA GTCAGGTCGA ATATGGTGTG TGAAGTAGCT ACATTGATAC CGATTTCATT GTCAAAATCA
CATCTTGGGG AAACTTTGGA GCTTGAGGTG GTTTTCATTT AGATGGATGC TTGTGCATAA GGATTTACGT TGTGCCCACG
TTAACAATGC CGAGCATATC TTTCCCTCTT CTGTTTTCTT TTGTAAATTT AGGCCTAGTT AGTTTTTTTT TAATCTGGAA
TGTTTTAGGA ATTTACTATG TTATTAGTTA AGTTAGGAGG TTCAGAGATA TCTTGTAATC TTATCCACCA ATTTCACTTA
ACTAATGGGA GCTGGAATTT GAGTGTAGTG CTTACATTCT TGCCCAAATG TTTGACTGCA TCGATTTATG TTACCAGGCA
GGAGTTTGAC ATAAACATCC TGTATTAGGT TTGCTGCATG GCATGTTTAC AGAAACTATT CAGCTAACCA AATTTTCCTC
TTAATGCAGG TAATTCTAGT GTTGAGGGTC TGAGGAGCTG AAACTAGCAC GGGTACCCTG GCAGCATGCG GTGGCTGGCT
CTCTCGGTAG ACATCTTCCG CAAAGGGATC TCCTTGAACC TGTACTGCCG GGTTATTCTG TAAATTGCCT CCATTATTGC
TCTACTCCAA TCCTGATCTT CTAGTCTCTG AAGTTTGGGA TTGAAGATCT GGTTGCTGGC ATTGCTGTTT GGGTTTCTGT
GGTTGCCTGG CAATTCTTTC AAGGAGAACG GGCAGGAGTA CTAATGGTGT GGCAACCGGT GGCTCAGACG AGATTCCGCG
TGTTTAAACA TGAGAATGGA ATCGCTGTGA GAGTTATAGC TTGCTTCCAG CCATCCCAAG ATTGCCAGGT AATGTAGAAA
CAAGTGACCT TTTTAAGGCT TGCTTTTCTT TGCTCTGAAC AATTCTAACA TTGATTTGAT ATGCTTGTTG CAGGCCGAGT
ACTTCCGCCA TCTTCTTAAG CCCGTGACGT AGTTCGACTC CCTCCCTTCC ATTTGCTGTT GAATAGAACC TGTGCTGCTC
TAAGTTTTTC TGAAGCAAAA GTAAAGCAGG AGAATTTCCT GTTCATCTCA ATTTTCTGGT GGTAAGAATC TCTTTTTCAT
CATCATGTGT ACCTATCTGT TTTCAATTAT GGGTAGATTA ATAATCAGTT TTTTTTTTTT TTTGCAATTT CAGAAGATCC
TGTTTGCTGG TTGTTTCTTG ATGGGGGAGA AGGTTAATCC CTGGTGCCAT TGGTCTAATC CCCCATGGAC CGAGAGCTCT
GCAAACAATC TCCACCCACC CGATGTTAGC CTCGACAACA CAAATTCAGT GGCGTTGCCA ACATATCTGA ACAGCGATGG
CTACATTTAT TCTGGAGTTG CTGCATCTAT GCCGTCTATT GCAGCATCAG TTACTGACAG ACCTGTTTCA TTCTCTTCTA
GATTTGTCAC AACATTGGTA CCCAGTGTAG GCTTATCAAC AGCTGAGACA CTGAGAAAGA GACCTCTGGT TTTCTTTCAT
AATGTGAATA ATACCTTCAC TGTAGGTCCT CTCCTGAGCA AGGGGACATT GGATACAGTT CCAGAGCTCC AAGGTAGCAA
TGAGACCAAT GTAACTGATG TTGGAGCACA AAATACTGAG TGTATGCATG AGAATACTGA GGAGATTGAT GCACTCCTGT
GTTCCGACTC AGATGAAGGG TGCTTGAAAG TGCAAGAACT CAACAACAGA GTCAGGAAAT ACCCAATGCA GAATGACACC
ATGAGTGTGG AGTCGGTAGC AAGCGCTGGT GCTTCCCAAC CAGCAAAGAA AAGAAGACTA AGCTCTGGTA CCGACAGATC
TGTGGTTGAC ACAGCCAGCT CAGCAAGGCC TGACCACTCC GTTGATCAGA AACATCTCAG CCATGACGAC GACGCACAGT
CGTGTTGTAT TGGTGAAGTG GAAAGCGATC ACCAGTTTGC TCTGAGGGAA GGTGAAGAAG CAGAAGGTGA TGATGGCCCC
GATGATCGGA AGCGGAGAAG AGAGAGGATC CAAGAGACTG TTGCTGCACT CAGAAAGATA GTTCCTGGAG GCATTGCCAA
AGATGCCACA GCCGTTCTTG ATGAAGCGAT ATGCTATCTC AAGTATCTAA AGCTCAAGGT CAAGACACTG GGAGCTGTTT
CCCTCTAGCT CCTCGATCGA TGACGGTTCT GTTCTGGTTC CTGAACCCAA TACCTATCCC TCTCTCCATA TATACAAGTA
ATGAGCTAAA ACTATAGCAG CAATAAGGTG AAATGAAACT CAGTCAGTTC CATTCGGTGA TTCTGAGGAC TACTGGAGTG
AAAGCTCAAT GGTGCTTTGC TTACAAGGGT CCAATGATTT GAGTGGTTAC AATGAAGATT CAGTATTGCA GTATATTACT
AGTGAATCAC CGACCACTGC ACCTTCATCC ATCCATCCAC TGATGGAGAG TACTACCTAG CAGCAAGCCG GTGTCACATC
TTTCTTCTGG GTCAGTTCAG TGCAGTGCCT CTTGGTAGGC ACCTCCTCCC TCTCATAAAA AAAGGCTCTC ATGGCGTTGA
TGGCGCAATA AGTAAAACAG GGAGGCTAAG CTATAAAGAT CTTTTTTCTC CCCTCCATTG TGGTGTGATC CAAAGCAAAG
GAAGGAAGGA GGAATGAATG AATGAAGTCC ATGCAAAGTG CAGTGCTGGT GGCCTGGTGC TGCATGCGTC GATGGCTTTT
TGACCCCCAA AGGTTGAGAG ATGAGATGGC GGGGCCGCGC CCGAGGTTAG TTCGGGCTCC TTGTGTGTGT TTGTATGGTG
GCGTGTGTAG CTAGCAGAGT GTGCGTGATG GCGTCGTCCC TCGCGCTTTT TCTGCCTTTC TACTAGTACT ATACATATAT
GCTACTGTAT ACTGTACTCC TATGTATGAA TACTGCATGT GTTTGTGTTT GTGTTTG

Locus: Os03g0391700

Loading...

Locus: Os03g0391700

Loading...