Os03t0393700-01

Locus

Os03g0393700

Description

Similar to Serine carboxypeptidase family protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SCP18

CGSNL Gene Name

SERINE CARBOXYPEPTIDASE 18

Oryzabase Gene Symbol Synonym(s)

OsSCP18

Oryzabase Gene Name Synonym(s)

Serine carboxypeptidase 18

Transcript Evidence

AK101332 (DDBJ, Best hit)

Protein Evidence

Q10K92 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Peptidase S10, serine carboxypeptidase (IPR001563)

Peptidase S10, serine carboxypeptidase, active site (IPR018202)

Full-length cDNA

J033034H21 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0393700-01)

Others

Oryzabase (19201)

Transcript

1550 bp

>Os03t0393700-01 Similar to Serine carboxypeptidase family protein, expressed.
GCACTAGCATACTGAGCCACTACGGCCCTCGATATGGACAGGCCCTATCCTCCTCTTCTT
CCCCTTGCTCTGCTCGCCCTcctcttcctctgtctcctccacggcgagcgcgccgccgcc
gccgacgacgacctCACCTCCGGCACCGGCGACGGCAGCGAGCTCTGGGGATACGTCCAA
GTTCGCCCGAAGGCGCACCTGTTCTGGTGGTACTACAAGAGCCCGCAGCGGGCGTCGTCG
CCGGGGAAGCCATGGCCGACCATCCTCTGGCTTCAGGGCGGCCCGGGAGCGTCGGGCGTC
GGGCTCGGCAACTTCCTGGAGGTCGGGCCGCTGGACGTCAACCTGAAGCCGCGCGACTCG
ACGTGGCTGCAGAAGGCCGACCTCATCTTCGTGGACAACCCGGTGGGCGTCGGGTACAGC
TACGCGGACGACCCGAGCGCGCTGGTGACGACGGACTGGCAGGCGGCCACGGACGCCACC
GAGCTGCTCAGGGCGCTCGCCGCCAAGGAGATACCCACCCTGCAGAGCAGCCCGCTGTTC
CTCGTCGCCGAGTCCTACGGCGGCAAGTACGCCGCCACGCTCGGCGTCTCCCTCGCCCGG
GCCATCCGCGCCGGCGACCTCAAGCTCAACCTCGGCGGCGTGGCGCTCGGCGACAGCTGG
ATCTCGCCGGAGGATTTCACGCTCGCGTACACGCCGCTGCTGCTGGAGGTGTCGAGGCTG
GACGACAACGCCGGCGACGAGGCCAGCAAGATGGCGGCGACGGTGAAGGAGCAGATCACG
GCGGGGCAGCTTGCGGACTCGCAGCAGTCGTGGATCGACCTGCTGGGTTTCATCGACAAA
AAGAGCGCCAGCGTCGACATGTACAATTTCTTGCTTGACTCCGGCATGGACCCGGTGTCG
GCAGACTTACCGGCGGCGAGCTCCTCATCGCCGTCGTCAAGCAGTGCTCAGTTGATGAAG
TACTCAACATACCTTAGCAGCCAAGCGGCCGATTCAGGCTCCAACACGATCGAGGGCATC
ATGAACGGTGTCATCAAGGAAAAGCTCAAGATCATCCCCAACAACCTCAAGTGGCAGGAA
CTGTCGGATCCGGTCTACAATGCGCTGGTCAACGATTTCATGAAGCCAAGAATCAACGAG
ATCGATGAGCTGCTGTCTTACGGTATCAATGTGACGGTCTACAATGGTCAGCTTGATGTA
ATATGCTCGACGATCGGTGCAGAAGCATGGGTGAAGAAGCTCAAATGGGATGGGCTGAAG
AACTTCCTGAGCCTACCAAGGCAGCCTTTGAAGTGTGGCTCTTCCAAGGGCACCAAGGCG
TTCGTCAGATCATACAAGAACCTGCATTTCTACTGGATACTTGGGGCTGGACACTTTGTA
CCTGCTGATCAGCCCTGCATTGCACTGAGCATGATCAGTAGCATAACCCAGTCTCCAGCC
AGTTAGATATCTCCCATCAGTAACAGATATACTCAAGAAAAGATAGAAAACAGAAGGCAA
ACAGATATACCTCACTCTCAATTAGCAGAGTGACATTGTACCGTTTCTTC

CDS

1413 bp

>Os03t0393700-01 Similar to Serine carboxypeptidase family protein, expressed.
ATGGACAGGCCCTATCCTCCTCTTCTTCCCCTTGCTCTGCTCGCCCTcctcttcctctgt
ctcctccacggcgagcgcgccgccgccgccgacgacgacctCACCTCCGGCACCGGCGAC
GGCAGCGAGCTCTGGGGATACGTCCAAGTTCGCCCGAAGGCGCACCTGTTCTGGTGGTAC
TACAAGAGCCCGCAGCGGGCGTCGTCGCCGGGGAAGCCATGGCCGACCATCCTCTGGCTT
CAGGGCGGCCCGGGAGCGTCGGGCGTCGGGCTCGGCAACTTCCTGGAGGTCGGGCCGCTG
GACGTCAACCTGAAGCCGCGCGACTCGACGTGGCTGCAGAAGGCCGACCTCATCTTCGTG
GACAACCCGGTGGGCGTCGGGTACAGCTACGCGGACGACCCGAGCGCGCTGGTGACGACG
GACTGGCAGGCGGCCACGGACGCCACCGAGCTGCTCAGGGCGCTCGCCGCCAAGGAGATA
CCCACCCTGCAGAGCAGCCCGCTGTTCCTCGTCGCCGAGTCCTACGGCGGCAAGTACGCC
GCCACGCTCGGCGTCTCCCTCGCCCGGGCCATCCGCGCCGGCGACCTCAAGCTCAACCTC
GGCGGCGTGGCGCTCGGCGACAGCTGGATCTCGCCGGAGGATTTCACGCTCGCGTACACG
CCGCTGCTGCTGGAGGTGTCGAGGCTGGACGACAACGCCGGCGACGAGGCCAGCAAGATG
GCGGCGACGGTGAAGGAGCAGATCACGGCGGGGCAGCTTGCGGACTCGCAGCAGTCGTGG
ATCGACCTGCTGGGTTTCATCGACAAAAAGAGCGCCAGCGTCGACATGTACAATTTCTTG
CTTGACTCCGGCATGGACCCGGTGTCGGCAGACTTACCGGCGGCGAGCTCCTCATCGCCG
TCGTCAAGCAGTGCTCAGTTGATGAAGTACTCAACATACCTTAGCAGCCAAGCGGCCGAT
TCAGGCTCCAACACGATCGAGGGCATCATGAACGGTGTCATCAAGGAAAAGCTCAAGATC
ATCCCCAACAACCTCAAGTGGCAGGAACTGTCGGATCCGGTCTACAATGCGCTGGTCAAC
GATTTCATGAAGCCAAGAATCAACGAGATCGATGAGCTGCTGTCTTACGGTATCAATGTG
ACGGTCTACAATGGTCAGCTTGATGTAATATGCTCGACGATCGGTGCAGAAGCATGGGTG
AAGAAGCTCAAATGGGATGGGCTGAAGAACTTCCTGAGCCTACCAAGGCAGCCTTTGAAG
TGTGGCTCTTCCAAGGGCACCAAGGCGTTCGTCAGATCATACAAGAACCTGCATTTCTAC
TGGATACTTGGGGCTGGACACTTTGTACCTGCTGATCAGCCCTGCATTGCACTGAGCATG
ATCAGTAGCATAACCCAGTCTCCAGCCAGTTAG

Protein

471 aa

>Os03t0393700-01 Similar to Serine carboxypeptidase family protein, expressed.
MDRPYPPLLPLALLALLFLCLLHGERAAAADDDLTSGTGDGSELWGYVQVRPKAHLFWWY
YKSPQRASSPGKPWPTILWLQGGPGASGVGLGNFLEVGPLDVNLKPRDSTWLQKADLIFV
DNPVGVGYSYADDPSALVTTDWQAATDATELLRALAAKEIPTLQSSPLFLVAESYGGKYA
ATLGVSLARAIRAGDLKLNLGGVALGDSWISPEDFTLAYTPLLLEVSRLDDNAGDEASKM
AATVKEQITAGQLADSQQSWIDLLGFIDKKSASVDMYNFLLDSGMDPVSADLPAASSSSP
SSSSAQLMKYSTYLSSQAADSGSNTIEGIMNGVIKEKLKIIPNNLKWQELSDPVYNALVN
DFMKPRINEIDELLSYGINVTVYNGQLDVICSTIGAEAWVKKLKWDGLKNFLSLPRQPLK
CGSSKGTKAFVRSYKNLHFYWILGAGHFVPADQPCIALSMISSITQSPAS*

5'UTR

chr03:15829071..15829103 (- strand) : 33 bp

CDS

chr03:15828914..15829070 (- strand) : 157 bp

chr03:15828732..15828826 (- strand) : 95 bp

chr03:15828535..15828642 (- strand) : 108 bp

chr03:15828143..15828430 (- strand) : 288 bp

chr03:15827968..15828035 (- strand) : 68 bp

chr03:15827747..15827852 (- strand) : 106 bp

chr03:15826291..15826505 (- strand) : 215 bp

chr03:15826072..15826141 (- strand) : 70 bp

chr03:15825922..15825972 (- strand) : 51 bp

chr03:15824959..15825011 (- strand) : 53 bp

chr03:15824741..15824873 (- strand) : 133 bp

chr03:15824212..15824280 (- strand) : 69 bp

3'UTR

chr03:15824108..15824211 (- strand) : 104 bp

FASTA

>Os03t0393700-01 class=Sequence position=chr03:15824108..15829103 (- strand)
GCACTAGCAT ACTGAGCCAC TACGGCCCTC GATATGGACA GGCCCTATCC TCCTCTTCTT CCCCTTGCTC TGCTCGCCCT
cctcttcctc tgtctcctcc acggcgagcg cgccgccgcc gccgacgacg acctCACCTC CGGCACCGGC GACGGCAGCG
AGCTCTGGGG ATACGTCCAA GTTCGCCCGA GTACGTCGAT CGACAACCAC TAATGAGCAT CTTTAATTAC TACTAAGTGC
TAAACTAAAT GTAAATATGC CATGTTCGTC GTTGCAGAGG CGCACCTGTT CTGGTGGTAC TACAAGAGCC CGCAGCGGGC
GTCGTCGCCG GGGAAGCCAT GGCCGACCAT CCTCTGGCTT CAGGGCGGCC CGGTACACAC TTCTCTTCAC CTTGAATTCT
AATCATGTTT GAGCTCAAGA ACGCTAATCG ATGCATGTCG TCGTCGTCGT CGTCGGAGCA GGGAGCGTCG GGCGTCGGGC
TCGGCAACTT CCTGGAGGTC GGGCCGCTGG ACGTCAACCT GAAGCCGCGC GACTCGACGT GGCTGCAGAA GGCCGACCTC
ATCTTCGTGG TGAGCGATCG AGACCGACGA ACACGCGGCG GAATTCTCCT TTCTTGCTCT GTTTCTGCTA CGTACATGAG
CTGACTTGTG TCAATGGTGG CGACGGCGAG CAGGACAACC CGGTGGGCGT CGGGTACAGC TACGCGGACG ACCCGAGCGC
GCTGGTGACG ACGGACTGGC AGGCGGCCAC GGACGCCACC GAGCTGCTCA GGGCGCTCGC CGCCAAGGAG ATACCCACCC
TGCAGAGCAG CCCGCTGTTC CTCGTCGCCG AGTCCTACGG CGGCAAGTAC GCCGCCACGC TCGGCGTCTC CCTCGCCCGG
GCCATCCGCG CCGGCGACCT CAAGCTCAAC CTCGGCGGCG TGGCGCTCGG CGACAGCTGG ATCTCGCCGG AGGATTTCAC
GGTGAGAAAA CAAAACGATT TTCTTGGAAT CCGCTCACAA TTCAACGCTG TATAGATCAA GCTCGGAAGG AATAATTCAT
GACGTTTTCT TGATGGATAT ATATGCAGCT CGCGTACACG CCGCTGCTGC TGGAGGTGTC GAGGCTGGAC GACAACGCCG
GCGACGAGGC CAGCAAGTAA GCCACGGCGG CGGCGGGCCG CGACGAATCG AAAGAAGAAA AAAACATAGC TAGGCTCTCT
CCGGCGAAGT CTCTAATTAA TGACGTACGT ATGTGTGAAC GGTGATGTCA GGATGGCGGC GACGGTGAAG GAGCAGATCA
CGGCGGGGCA GCTTGCGGAC TCGCAGCAGT CGTGGATCGA CCTGCTGGGT TTCATCGACA AAAAGAGCGC CAGCGTCGTA
AGTGTTCGCC ACTGCACGCC ACGCGTAGCA CTCACACGCT TTTATTTTGA GGATTTTATG ATCATATATA CTATTTTCTA
TTGGAAAACT TATCTTAGAG ATACCCCAAG TATACAATTA ATTAAAAAAT TGGTACCTCT GTGAATTGTG GGGATAATTT
AGGTGAAAAT TTTGAATTCT GTTACATATT AGGGGAAATT TTCTTTTTTA CCACCATTAA TCTTGAAAAT TTTATTTTGT
TGATGCTATC TGGACACCTT TTTTTTGTTA CTCATTTTTT TATCTTTTCT TTTGTTACTC ATTAGTATAT GGTCAGTAGC
AAAATAAAAA ATAAAGCTTA CTCATTAATT GTTAAACCAT TTAAATTGAT TGCGAGAATC ATATTATTAG ATTTTGCCAC
GTCAGAACAA TAGTATAGTT TTATCATCGC GTTGGACGTA AATTACTGTA AGCATGAGTC AAAGATGCAT ATGACGCGAA
AGTCCAAAGA ACATGGTAGT ACTATTTTCT TTAACCAACA TAACTATCCA TTAGAAAGGA CTTTCGTTTG GAAACATTTT
TCGatactgt caaattactc tcattaatct aacattgaat atattttgat actgtgtttg attaatgttg aaaatacgac
tatttctttt tataaactta gtgactagaa aaaaacttca aacgacatac aatatgaata tgaaagaagg gagtaCTGAT
CAGAGGTAGC TAGCTTGTAA GAGTCAGTTT GTCTAAAGAG ATAAAGTTGT TTAGGAAGAT TGTTTTCGAT AGGACAATTT
TCTCATGTTT GTTAGGACTA TGTTATTATT ACAGAATTTT CGTTCTTCTT TTGTTGTTTT GTTATCATTC TTTGAAAGAG
ACGGGATCAA GTAGAAAGGA GACAAGGTTC ACCCACCGCC ATCTTTTTAA TTTAGTACAA TGCACACAGA AAAGGGCGAG
AAAGCCGCAA AAATCTGTAT TTAATATCAG CATTTTGCAG ATTATATTCA CACCCAGTCA GCAGTACAGC TAGCTTGATC
ACACTAGAGT CGTTGTTTAG GATCACACTA GAGTCGTTGT ttaggccgtg tttagttgca gattttttct tcaaacttcc
aacttttcca tcacatcaaa acttttctac acacaaactt ccaacttttc cgtcacatcg tttcaatttc aatcaaattt
ctaattttaa cgttaactaa acaaaccctT ATTTGCAGGA CATGTACAAT TTCTTGCTTG ACTCCGGCAT GGACCCGGTG
TCGGCAGACT TACCGGCGGC GAGCTCCTCA TCGCCGTCGT CAAGCAGTGC TCAGTTGATG AAGTACTCAA CATACCTTAG
CAGCCAAGCG GCCGATTCAG GCTCCAACAC GATCGAGGGC ATCATGAACG GTGTCATCAA GGAAAAGCTC AAGATCATCC
CCAACAACCT CAAGTGGGTG TCCATTTCTT TCGCTGTTTC ACATCACAAT GACCAGCACA ACTGTCCAAA TCACGTTCGC
ACGCTGATTT TTTTCAATTT ATTACTGTCC AAATCATCCT CCTCATCCTT GAGAAAACGC TGCAATTTCA ACTGAACTGC
AGGTGGCAGG AACTGTCGGA TCCGGTCTAC AATGCGCTGG TCAACGATTT CATGAAGCCA AGAATCAACG AGGTGATCTA
CTAAGTATTA ATGAATGCGT CTTTAACTTG TAAAATTCCT GATGAAATTA ATGGTCCATG TTTGATTAAC TGTCTGTGTG
CCCTGTTCCA GATCGATGAG CTGCTGTCTT ACGGTATCAA TGTGACGGTC TACAATGGTC AGGTAACTAC TGACTACCGA
GCACTGACAA TTCTGCTAGG TGCATAGCAC ACACAAAATG AGCAGGATTT ATGTCACAAA AGTCCAAATT AGATGGGGAT
GCATAGTTTG ATTGATTAAT TGGTAGTACA TATATCCAGC TAATAAGATG GGGATTCCTT GCATGTTACC AATTGATGCT
GGAAGCATCT TGAGTAAGCA ACAAGAAGTA TATAAGAATA AAGGGTGCTG CTAGTCAGTG GGAGAGCAGG ATAACGTGAA
GCCGACGAGT TGTTGTTCAG AAAAGGCGGC ACCCTTTCTG AAATTTGGGT TAACTTCCAC TGTAAAGTTC AGAGATCATT
AGTGACAGCC ACATCCTGCA GCCAAGGGGT CCAGGCATGC CTGGCTAGGA TTAGAGGGAA ACTTCCTTGC GTGAAGAGCT
CTCCAATCGG AGCACTTTTG CTCAGGAGTT GAGTGAGCAG CAAGAGATCT GCAGATTGCA AGAGCCATCT ACTCTCACAT
GTTATTGCTC ACATGGTCAA GGTCAACAGT TTGGAGAGAA ATCATGTGTT ATTTGAGGCC TGAAGTTTGC TAATTTTCTT
TTAGTGATGC ATAACTAAAA AAAAAGTCAT TAAATCAACA AATTAGGTCA GCTAGCACTA CAACTCTGTA AATTCAGAGT
AGTAATTCAG TGCAGGGATT GAACTTCCGG AACAAAATAT TCGAAAATCT CGGTAATTTC GCCACCCCCA GCAAGCAAAT
ATTTCGTACG AATGTTTTGG ATTTCCCCAG ATATTTGTGA ATTTAGCCAT AATTTATTCA AATTCGGCAA AAATGGGTTA
AATTTTCAAA AAGTTCGTTG GACATATCTT AAATGTCGGT GCCTTTCGAA AGTGCAAACC CTGATTTGGT GTGTTATTTT
TCTCTTCTGA AGCTTGATGT AATATGCTCG ACGATCGGTG CAGAAGCATG GGTGAAGAAG CTCAAGTAAG GGATTATTTT
CCCCTTCCAA CTTTTTCTAG TTTGTTGAAC AATTCAGATG TGTGATGAAG AGCTTTGTTA TGAATTTCAG ATGGGATGGG
CTGAAGAACT TCCTGAGCCT ACCAAGGCAG CCTTTGAAGT GTGGCTCTTC CAAGGGCACC AAGGCGTTCG TCAGATCATA
CAAGAACCTG CATTTCTACT GGATACTTGG GGCTGGACAC TTTGTAAGTC TCAACATACA CATGCCACAC TACTAAAAAA
AAACGCATGC CACTACTAGA AAAACTCTAG TTACAAGTTT GATTTCTAAG GCCGTGTTTA AATTCAAATT TTTTTCGtca
aacttccaac ttttccgtca caacaaatat ttagatatat gcatggagca ttaaatgtgg atgaaaaaaa tcaattggac
agtttgtatg taaattgcaa gacgaatctt ttgagcctaa ttacgcattg atttgacaat gtgaacattt gctaatgacg
gattaactag gcttaataaa ttcgtctcgc aatttacatg cggaatctgt aatttgtttt gttattagtc tacgtttaat
acttcaaata ttatgtgccc atatacttaa aaaaaatttt ggcacacgaa ttaaacacag ccTAACCTGA ATTGTACGTT
TACATGTGTT ATGTTCTCTG CAGGTACCTG CTGATCAGCC CTGCATTGCA CTGAGCATGA TCAGTAGCAT AACCCAGTCT
CCAGCCAGTT AGATATCTCC CATCAGTAAC AGATATACTC AAGAAAAGAT AGAAAACAGA AGGCAAACAG ATATACCTCA
CTCTCAATTA GCAGAGTGAC ATTGTACCGT TTCTTC