Os03t0393700-02

Locus

Os03g0393700

Description

Similar to Serine carboxypeptidase family protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SCP18

CGSNL Gene Name

SERINE CARBOXYPEPTIDASE 18

Oryzabase Gene Symbol Synonym(s)

OsSCP18

Oryzabase Gene Name Synonym(s)

Serine carboxypeptidase 18

Transcript Evidence

AK119753 (DDBJ, Best hit)

Protein Evidence

Q10K92 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Peptidase S10, serine carboxypeptidase (IPR001563)

Full-length cDNA

002-167-E02 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0393700-02)

Others

Oryzabase (19201)

Transcript

2360 bp

>Os03t0393700-02 Similar to Serine carboxypeptidase family protein, expressed.
ACTAGCATACTGAGCCACTACGGCCCTCGATATGGACAGGCCCTATCCTCCTCTTCTTCC
CCTTGCTCTGCTCGCCCTcctcttcctctgtctcctccacggcgagcgcgccgccgccgc
cgacgacgacctCACCTCCGGCACCGGCGACGGCAGCGAGCTCTGGGGATACGTCCAAGT
TCGCCCGAAGGCGCACCTGTTCTGGTGGTACTACAAGAGCCCGCAGCGGGCGTCGTCGCC
GGGGAAGCCATGGCCGACCATCCTCTGGCTTCAGGGCGGCCCGGGAGCGTCGGGCGTCGG
GCTCGGCAACTTCCTGGAGGTCGGGCCGCTGGACGTCAACCTGAAGCCGCGCGACTCGAC
GTGGCTGCAGAAGGCCGACCTCATCTTCGTGGTGAGCGATCGAGACCGACGAACACGCGG
CGGAATTCTCCTTTCTTGCTCTGTTTCTGCTACGTACATGAGCTGACTTGTGTCAATGGT
GGCGACGGCGAGCAGGACAACCCGGTGGGCGTCGGGTACAGCTACGCGGACGACCCGAGC
GCGCTGGTGACGACGGACTGGCAGGCGGCCACGGACGCCACCGAGCTGCTCAGGGCGCTC
GCCGCCAAGGAGATACCCACCCTGCAGAGCAGCCCGCTGTTCCTCGTCGCCGAGTCCTAC
GGCGGCAAGTACGCCGCCACGCTCGGCGTCTCCCTCGCCCGGGCCATCCGCGCCGGCGAC
CTCAAGCTCAACCTCGGCGGCGTGGCGCTCGGCGACAGCTGGATCTCGCCGGAGGATTTC
ACGCTCGCGTACACGCCGCTGCTGCTGGAGGTGTCGAGGCTGGACGACAACGCCGGCGAC
GAGGCCAGCAAGATGGCGGCGACGGTGAAGGAGCAGATCACGGCGGGGCAGCTTGCGGAC
TCGCAGCAGTCGTGGATCGACCTGCTGGGTTTCATCGACAAAAAGAGCGCCAGCGTCGAC
ATGTACAATTTCTTGCTTGACTCCGGCATGGACCCGGTGTCGGCAGACTTACCGGCGGCG
AGCTCCTCATCGCCGTCGTCAAGCAGTGCTCAGTTGATGAAGTACTCAACATACCTTAGC
AGCCAAGCGGCCGATTCAGGCTCCAACACGATCGAGGGCATCATGAACGGTGTCATCAAG
GAAAAGCTCAAGATCATCCCCAACAACCTCAAGTGGGTGTCCATTTCTTTCGCTGTTTCA
CATCACAATGACCAGCACAACTGTCCAAATCACGTTCGCACGCTGATTTTTTTCAATTTA
TTACTGTCCAAATCATCCTCCTCATCCTTGAGAAAACGCTGCAATTTCAACTGAACTGCA
GGTGGCAGGAACTGTCGGATCCGGTCTACAATGCGCTGGTCAACGATTTCATGAAGCCAA
GAATCAACGAGGTGATCTACTAAGTATTAATGAATGCGTCTTTAACTTGTAAAATTCCTG
ATGAAATTAATGGTCCATGTTTGATTAACTGTCTGTGTGCCCTGTTCCAGATCGATGAGC
TGCTGTCTTACGGTATCAATGTGACGGTCTACAATGGTCAGCTTGATGTAATATGCTCGA
CGATCGGTGCAGAAGCATGGGTGAAGAAGCTCAAATGGGATGGGCTGAAGAACTTCCTGA
GCCTACCAAGGCAGCCTTTGAAGTGTGGCTCTTCCAAGGGCACCAAGGCGTTCGTCAGAT
CATACAAGAACCTGCATTTCTACTGGATACTTGGGGCTGGACACTTTGTAAGTCTCAACA
TACACATGCCACACTACTAAAAAAAAACGCATGCCACTACTAGAAAAACTCTAGTTACAA
GTTTGATTTCTAAGGCCGTGTTTAAATTCAAATTTTTTTCGtcaaacttccaacttttcc
gtcacaacaaatatttagatatatgcatggagcattaaatgtggatgaaaaaaatcaatt
ggacagtttgtatgtaaattgcaagacgaatcttttgagcctaattacgcattgatttga
caatgtgaacatttgctaatgacggattaactaggcttaataaattcgtctcgcaattta
catgcggaatctgtaatttgttttgttattagtctacgtttaatacttcaaatattatgt
gcccatatacttaaaaaaaattttggcacacgaattaaacacagccTAACCTGAATTGTA
CGTTTACATGTGTTATGTTCTCTGCAGGTACCTGCTGATCAGCCCTGCATTGCACTGAGC
ATGATCAGTAGCATAACCCAGTCTCCAGCCAGTTAGATATCTCCCATCAGTAACAGATAT
ACTCAAGAAAAGATAGAAAACAGAAGGCAAACAGATATACCTCACTCTCAATTAGCAGAG
TGACATTGTACCGTTTCTTC

CDS

435 bp

>Os03t0393700-02 Similar to Serine carboxypeptidase family protein, expressed.
ATGGACAGGCCCTATCCTCCTCTTCTTCCCCTTGCTCTGCTCGCCCTcctcttcctctgt
ctcctccacggcgagcgcgccgccgccgccgacgacgacctCACCTCCGGCACCGGCGAC
GGCAGCGAGCTCTGGGGATACGTCCAAGTTCGCCCGAAGGCGCACCTGTTCTGGTGGTAC
TACAAGAGCCCGCAGCGGGCGTCGTCGCCGGGGAAGCCATGGCCGACCATCCTCTGGCTT
CAGGGCGGCCCGGGAGCGTCGGGCGTCGGGCTCGGCAACTTCCTGGAGGTCGGGCCGCTG
GACGTCAACCTGAAGCCGCGCGACTCGACGTGGCTGCAGAAGGCCGACCTCATCTTCGTG
GTGAGCGATCGAGACCGACGAACACGCGGCGGAATTCTCCTTTCTTGCTCTGTTTCTGCT
ACGTACATGAGCTGA

Protein

145 aa

>Os03t0393700-02 Similar to Serine carboxypeptidase family protein, expressed.
MDRPYPPLLPLALLALLFLCLLHGERAAAADDDLTSGTGDGSELWGYVQVRPKAHLFWWY
YKSPQRASSPGKPWPTILWLQGGPGASGVGLGNFLEVGPLDVNLKPRDSTWLQKADLIFV
VSDRDRRTRGGILLSCSVSATYMS*

5'UTR

chr03:15829071..15829101 (- strand) : 31 bp

CDS

chr03:15828914..15829070 (- strand) : 157 bp

chr03:15828732..15828826 (- strand) : 95 bp

chr03:15828460..15828642 (- strand) : 183 bp

3'UTR

chr03:15828143..15828459 (- strand) : 317 bp

chr03:15827968..15828035 (- strand) : 68 bp

chr03:15827747..15827852 (- strand) : 106 bp

chr03:15825922..15826505 (- strand) : 584 bp

chr03:15824959..15825011 (- strand) : 53 bp

chr03:15824108..15824873 (- strand) : 766 bp

FASTA

>Os03t0393700-02 class=Sequence position=chr03:15824108..15829101 (- strand)
ACTAGCATAC TGAGCCACTA CGGCCCTCGA TATGGACAGG CCCTATCCTC CTCTTCTTCC CCTTGCTCTG CTCGCCCTcc
tcttcctctg tctcctccac ggcgagcgcg ccgccgccgc cgacgacgac ctCACCTCCG GCACCGGCGA CGGCAGCGAG
CTCTGGGGAT ACGTCCAAGT TCGCCCGAGT ACGTCGATCG ACAACCACTA ATGAGCATCT TTAATTACTA CTAAGTGCTA
AACTAAATGT AAATATGCCA TGTTCGTCGT TGCAGAGGCG CACCTGTTCT GGTGGTACTA CAAGAGCCCG CAGCGGGCGT
CGTCGCCGGG GAAGCCATGG CCGACCATCC TCTGGCTTCA GGGCGGCCCG GTACACACTT CTCTTCACCT TGAATTCTAA
TCATGTTTGA GCTCAAGAAC GCTAATCGAT GCATGTCGTC GTCGTCGTCG TCGGAGCAGG GAGCGTCGGG CGTCGGGCTC
GGCAACTTCC TGGAGGTCGG GCCGCTGGAC GTCAACCTGA AGCCGCGCGA CTCGACGTGG CTGCAGAAGG CCGACCTCAT
CTTCGTGGTG AGCGATCGAG ACCGACGAAC ACGCGGCGGA ATTCTCCTTT CTTGCTCTGT TTCTGCTACG TACATGAGCT
GACTTGTGTC AATGGTGGCG ACGGCGAGCA GGACAACCCG GTGGGCGTCG GGTACAGCTA CGCGGACGAC CCGAGCGCGC
TGGTGACGAC GGACTGGCAG GCGGCCACGG ACGCCACCGA GCTGCTCAGG GCGCTCGCCG CCAAGGAGAT ACCCACCCTG
CAGAGCAGCC CGCTGTTCCT CGTCGCCGAG TCCTACGGCG GCAAGTACGC CGCCACGCTC GGCGTCTCCC TCGCCCGGGC
CATCCGCGCC GGCGACCTCA AGCTCAACCT CGGCGGCGTG GCGCTCGGCG ACAGCTGGAT CTCGCCGGAG GATTTCACGG
TGAGAAAACA AAACGATTTT CTTGGAATCC GCTCACAATT CAACGCTGTA TAGATCAAGC TCGGAAGGAA TAATTCATGA
CGTTTTCTTG ATGGATATAT ATGCAGCTCG CGTACACGCC GCTGCTGCTG GAGGTGTCGA GGCTGGACGA CAACGCCGGC
GACGAGGCCA GCAAGTAAGC CACGGCGGCG GCGGGCCGCG ACGAATCGAA AGAAGAAAAA AACATAGCTA GGCTCTCTCC
GGCGAAGTCT CTAATTAATG ACGTACGTAT GTGTGAACGG TGATGTCAGG ATGGCGGCGA CGGTGAAGGA GCAGATCACG
GCGGGGCAGC TTGCGGACTC GCAGCAGTCG TGGATCGACC TGCTGGGTTT CATCGACAAA AAGAGCGCCA GCGTCGTAAG
TGTTCGCCAC TGCACGCCAC GCGTAGCACT CACACGCTTT TATTTTGAGG ATTTTATGAT CATATATACT ATTTTCTATT
GGAAAACTTA TCTTAGAGAT ACCCCAAGTA TACAATTAAT TAAAAAATTG GTACCTCTGT GAATTGTGGG GATAATTTAG
GTGAAAATTT TGAATTCTGT TACATATTAG GGGAAATTTT CTTTTTTACC ACCATTAATC TTGAAAATTT TATTTTGTTG
ATGCTATCTG GACACCTTTT TTTTGTTACT CATTTTTTTA TCTTTTCTTT TGTTACTCAT TAGTATATGG TCAGTAGCAA
AATAAAAAAT AAAGCTTACT CATTAATTGT TAAACCATTT AAATTGATTG CGAGAATCAT ATTATTAGAT TTTGCCACGT
CAGAACAATA GTATAGTTTT ATCATCGCGT TGGACGTAAA TTACTGTAAG CATGAGTCAA AGATGCATAT GACGCGAAAG
TCCAAAGAAC ATGGTAGTAC TATTTTCTTT AACCAACATA ACTATCCATT AGAAAGGACT TTCGTTTGGA AACATTTTTC
Gatactgtca aattactctc attaatctaa cattgaatat attttgatac tgtgtttgat taatgttgaa aatacgacta
tttcttttta taaacttagt gactagaaaa aaacttcaaa cgacatacaa tatgaatatg aaagaaggga gtaCTGATCA
GAGGTAGCTA GCTTGTAAGA GTCAGTTTGT CTAAAGAGAT AAAGTTGTTT AGGAAGATTG TTTTCGATAG GACAATTTTC
TCATGTTTGT TAGGACTATG TTATTATTAC AGAATTTTCG TTCTTCTTTT GTTGTTTTGT TATCATTCTT TGAAAGAGAC
GGGATCAAGT AGAAAGGAGA CAAGGTTCAC CCACCGCCAT CTTTTTAATT TAGTACAATG CACACAGAAA AGGGCGAGAA
AGCCGCAAAA ATCTGTATTT AATATCAGCA TTTTGCAGAT TATATTCACA CCCAGTCAGC AGTACAGCTA GCTTGATCAC
ACTAGAGTCG TTGTTTAGGA TCACACTAGA GTCGTTGTtt aggccgtgtt tagttgcaga ttttttcttc aaacttccaa
cttttccatc acatcaaaac ttttctacac acaaacttcc aacttttccg tcacatcgtt tcaatttcaa tcaaatttct
aattttaacg ttaactaaac aaaccctTAT TTGCAGGACA TGTACAATTT CTTGCTTGAC TCCGGCATGG ACCCGGTGTC
GGCAGACTTA CCGGCGGCGA GCTCCTCATC GCCGTCGTCA AGCAGTGCTC AGTTGATGAA GTACTCAACA TACCTTAGCA
GCCAAGCGGC CGATTCAGGC TCCAACACGA TCGAGGGCAT CATGAACGGT GTCATCAAGG AAAAGCTCAA GATCATCCCC
AACAACCTCA AGTGGGTGTC CATTTCTTTC GCTGTTTCAC ATCACAATGA CCAGCACAAC TGTCCAAATC ACGTTCGCAC
GCTGATTTTT TTCAATTTAT TACTGTCCAA ATCATCCTCC TCATCCTTGA GAAAACGCTG CAATTTCAAC TGAACTGCAG
GTGGCAGGAA CTGTCGGATC CGGTCTACAA TGCGCTGGTC AACGATTTCA TGAAGCCAAG AATCAACGAG GTGATCTACT
AAGTATTAAT GAATGCGTCT TTAACTTGTA AAATTCCTGA TGAAATTAAT GGTCCATGTT TGATTAACTG TCTGTGTGCC
CTGTTCCAGA TCGATGAGCT GCTGTCTTAC GGTATCAATG TGACGGTCTA CAATGGTCAG GTAACTACTG ACTACCGAGC
ACTGACAATT CTGCTAGGTG CATAGCACAC ACAAAATGAG CAGGATTTAT GTCACAAAAG TCCAAATTAG ATGGGGATGC
ATAGTTTGAT TGATTAATTG GTAGTACATA TATCCAGCTA ATAAGATGGG GATTCCTTGC ATGTTACCAA TTGATGCTGG
AAGCATCTTG AGTAAGCAAC AAGAAGTATA TAAGAATAAA GGGTGCTGCT AGTCAGTGGG AGAGCAGGAT AACGTGAAGC
CGACGAGTTG TTGTTCAGAA AAGGCGGCAC CCTTTCTGAA ATTTGGGTTA ACTTCCACTG TAAAGTTCAG AGATCATTAG
TGACAGCCAC ATCCTGCAGC CAAGGGGTCC AGGCATGCCT GGCTAGGATT AGAGGGAAAC TTCCTTGCGT GAAGAGCTCT
CCAATCGGAG CACTTTTGCT CAGGAGTTGA GTGAGCAGCA AGAGATCTGC AGATTGCAAG AGCCATCTAC TCTCACATGT
TATTGCTCAC ATGGTCAAGG TCAACAGTTT GGAGAGAAAT CATGTGTTAT TTGAGGCCTG AAGTTTGCTA ATTTTCTTTT
AGTGATGCAT AACTAAAAAA AAAGTCATTA AATCAACAAA TTAGGTCAGC TAGCACTACA ACTCTGTAAA TTCAGAGTAG
TAATTCAGTG CAGGGATTGA ACTTCCGGAA CAAAATATTC GAAAATCTCG GTAATTTCGC CACCCCCAGC AAGCAAATAT
TTCGTACGAA TGTTTTGGAT TTCCCCAGAT ATTTGTGAAT TTAGCCATAA TTTATTCAAA TTCGGCAAAA ATGGGTTAAA
TTTTCAAAAA GTTCGTTGGA CATATCTTAA ATGTCGGTGC CTTTCGAAAG TGCAAACCCT GATTTGGTGT GTTATTTTTC
TCTTCTGAAG CTTGATGTAA TATGCTCGAC GATCGGTGCA GAAGCATGGG TGAAGAAGCT CAAGTAAGGG ATTATTTTCC
CCTTCCAACT TTTTCTAGTT TGTTGAACAA TTCAGATGTG TGATGAAGAG CTTTGTTATG AATTTCAGAT GGGATGGGCT
GAAGAACTTC CTGAGCCTAC CAAGGCAGCC TTTGAAGTGT GGCTCTTCCA AGGGCACCAA GGCGTTCGTC AGATCATACA
AGAACCTGCA TTTCTACTGG ATACTTGGGG CTGGACACTT TGTAAGTCTC AACATACACA TGCCACACTA CTAAAAAAAA
ACGCATGCCA CTACTAGAAA AACTCTAGTT ACAAGTTTGA TTTCTAAGGC CGTGTTTAAA TTCAAATTTT TTTCGtcaaa
cttccaactt ttccgtcaca acaaatattt agatatatgc atggagcatt aaatgtggat gaaaaaaatc aattggacag
tttgtatgta aattgcaaga cgaatctttt gagcctaatt acgcattgat ttgacaatgt gaacatttgc taatgacgga
ttaactaggc ttaataaatt cgtctcgcaa tttacatgcg gaatctgtaa tttgttttgt tattagtcta cgtttaatac
ttcaaatatt atgtgcccat atacttaaaa aaaattttgg cacacgaatt aaacacagcc TAACCTGAAT TGTACGTTTA
CATGTGTTAT GTTCTCTGCA GGTACCTGCT GATCAGCCCT GCATTGCACT GAGCATGATC AGTAGCATAA CCCAGTCTCC
AGCCAGTTAG ATATCTCCCA TCAGTAACAG ATATACTCAA GAAAAGATAG AAAACAGAAG GCAAACAGAT ATACCTCACT
CTCAATTAGC AGAGTGACAT TGTACCGTTT CTTC