Os03t0393700-03

Locus

Os03g0393700

Description

Similar to Serine carboxypeptidase family protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SCP18

CGSNL Gene Name

SERINE CARBOXYPEPTIDASE 18

Oryzabase Gene Symbol Synonym(s)

OsSCP18

Oryzabase Gene Name Synonym(s)

Serine carboxypeptidase 18

Transcript Evidence

AK058801 (DDBJ, Best hit)

Protein Evidence

Q10K92 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Peptidase S10, serine carboxypeptidase (IPR001563)

Full-length cDNA

001-003-A09 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0393700-03)

RiceXPro (AK058801)

Others

Oryzabase (19201)

KEGG (Os03t0393700-03 (EC:3.4.16.-))

Transcript

527 bp

>Os03t0393700-03 Similar to Serine carboxypeptidase family protein, expressed.
CGTACGAATGTTTTGGATTTCCCCAGATATTTGTGAATTTAGCCATAATTTATTCAAATT
CGGCAAAAATGGGTTAAATTTTCAAAAAGTTCGTTGGACATATCTTAAATGTCGGTGCCT
TTCGAAAGTGCAAACCCTGATTTGGTGTGTTATTTTTCTCTTCTGAAGCTTGATGTAATA
TGCTCGACGATCGGTGCAGAAGCATGGGTGAAGAAGCTCAAATGGGATGGGCTGAAGAAC
TTCCTGAGCCTACCAAGGCAGCCTTTGAAGTGTGGCTCTTCCAAGGGCACCAAGGCGTTC
GTCAGATCATACAAGAACCTGCATTTCTACTGGATACTTGGGGCTGGACACTTTGTACCT
GCTGATCAGCCCTGCATTGCACTGAGCATGATCAGTAGCATAACCCAGTCTCCAGCCAGT
TAGATATCTCCCATCAGTAACAGATATACTCAAGAAAAGATAGAAAACAGAAGGCAAACA
GATATACCTCACTCTCAATTAGCAGAGTGACATTGTACCGTTTCTTC

CDS

315 bp

>Os03t0393700-03 Similar to Serine carboxypeptidase family protein, expressed.
ATGTCGGTGCCTTTCGAAAGTGCAAACCCTGATTTGGTGTGTTATTTTTCTCTTCTGAAG
CTTGATGTAATATGCTCGACGATCGGTGCAGAAGCATGGGTGAAGAAGCTCAAATGGGAT
GGGCTGAAGAACTTCCTGAGCCTACCAAGGCAGCCTTTGAAGTGTGGCTCTTCCAAGGGC
ACCAAGGCGTTCGTCAGATCATACAAGAACCTGCATTTCTACTGGATACTTGGGGCTGGA
CACTTTGTACCTGCTGATCAGCCCTGCATTGCACTGAGCATGATCAGTAGCATAACCCAG
TCTCCAGCCAGTTAG

Protein

105 aa

>Os03t0393700-03 Similar to Serine carboxypeptidase family protein, expressed.
MSVPFESANPDLVCYFSLLKLDVICSTIGAEAWVKKLKWDGLKNFLSLPRQPLKCGSSKG
TKAFVRSYKNLHFYWILGAGHFVPADQPCIALSMISSITQSPAS*

5'UTR

chr03:15825072..15825179 (- strand) : 108 bp

CDS

chr03:15824959..15825071 (- strand) : 113 bp

chr03:15824741..15824873 (- strand) : 133 bp

chr03:15824212..15824280 (- strand) : 69 bp

3'UTR

chr03:15824108..15824211 (- strand) : 104 bp

FASTA

>Os03t0393700-03 class=Sequence position=chr03:15824108..15825179 (- strand)
CGTACGAATG TTTTGGATTT CCCCAGATAT TTGTGAATTT AGCCATAATT TATTCAAATT CGGCAAAAAT GGGTTAAATT
TTCAAAAAGT TCGTTGGACA TATCTTAAAT GTCGGTGCCT TTCGAAAGTG CAAACCCTGA TTTGGTGTGT TATTTTTCTC
TTCTGAAGCT TGATGTAATA TGCTCGACGA TCGGTGCAGA AGCATGGGTG AAGAAGCTCA AGTAAGGGAT TATTTTCCCC
TTCCAACTTT TTCTAGTTTG TTGAACAATT CAGATGTGTG ATGAAGAGCT TTGTTATGAA TTTCAGATGG GATGGGCTGA
AGAACTTCCT GAGCCTACCA AGGCAGCCTT TGAAGTGTGG CTCTTCCAAG GGCACCAAGG CGTTCGTCAG ATCATACAAG
AACCTGCATT TCTACTGGAT ACTTGGGGCT GGACACTTTG TAAGTCTCAA CATACACATG CCACACTACT AAAAAAAAAC
GCATGCCACT ACTAGAAAAA CTCTAGTTAC AAGTTTGATT TCTAAGGCCG TGTTTAAATT CAAATTTTTT TCGtcaaact
tccaactttt ccgtcacaac aaatatttag atatatgcat ggagcattaa atgtggatga aaaaaatcaa ttggacagtt
tgtatgtaaa ttgcaagacg aatcttttga gcctaattac gcattgattt gacaatgtga acatttgcta atgacggatt
aactaggctt aataaattcg tctcgcaatt tacatgcgga atctgtaatt tgttttgtta ttagtctacg tttaatactt
caaatattat gtgcccatat acttaaaaaa aattttggca cacgaattaa acacagccTA ACCTGAATTG TACGTTTACA
TGTGTTATGT TCTCTGCAGG TACCTGCTGA TCAGCCCTGC ATTGCACTGA GCATGATCAG TAGCATAACC CAGTCTCCAG
CCAGTTAGAT ATCTCCCATC AGTAACAGAT ATACTCAAGA AAAGATAGAA AACAGAAGGC AAACAGATAT ACCTCACTCT
CAATTAGCAG AGTGACATTG TACCGTTTCT TC