Os03t0393900-01

Locus

Os03g0393900

Description

Pollen-specific phospholipase, Patatin like phospholipase A, Pollen viability

RAP-DB Gene Symbol Synonym(s)

OsMATL, OspPLAIIφ, OspPLAIIphi, OsPLP1, PLP1, OspPLAIIbeta

RAP-DB Gene Name Synonym(s)

MATRILINEAL, Patatin-like protein 1, Patatin-related phospholipase A II beta

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OspPLAIIbeta, pPLAIIbeta, OspPLAIIphi, pPLAIIphi, NLD, PLP1, OspPLAIIphi/PLP1, OsMATL, MATL

Oryzabase Gene Name Synonym(s)

Patatin-related phospholipase A II beta, MATRILINEAL, PHOSPHOLIPASE A1, NOT LIKE DAD

Transcript Evidence

AK069809

Protein Evidence

Q84QY3

Literature

PMID: 29988153

PMID: 26290597

PMID: 22363522

Note

Manual Curation

July 17, 2018

Gene Ontology (GO)

Biological Process: lipid metabolic process (GO:0006629)

Biological Process: metabolic process (GO:0008152)

Functional domain (InterPro)

Acyl transferase/acyl hydrolase/lysophospholipase (IPR016035)

Patatin-like phospholipase domain (IPR002641)

Full-length cDNA

J023030J03 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0393900-01)

RiceXPro (AK069809)

Others

Oryzabase (19861)

KEGG (Os03t0393900-01)

Transcript

1525 bp

>Os03t0393900-01 Pollen-specific phospholipase, Patatin like phospholipase A, Pollen viability
ACAGTGACTAGTGACAAACGATCGATCGATCCCTCCATCCACAAACCCTCCTCGATCTCA
TCTTCCTTCGTCTCGTCAATGGCGGCGAGCTACTCGTGCCGGCGGACATGCGAGGCGTGC
AGCACGAGGGCGATGGCCGGGTGCGTGGTGGGCGAGCCGGCGTCGGCGCCGGGGCAGCGG
GTGACGTTGCTGGCGATCGACGGCGGCGGCATCAGGGGCCTCATCCCGGGCACCATCCTC
GCCTTCCTCGAGGCCAGGCTGCAGGAGCTGGATGGCCCCGACGCGCGCCTCGCCGATTAC
TTCGACTGCATCGCCGGGACCAGCACCGGCGGCCTCATCACCGCCATGCTCGCCGCGCCC
GGCGACCACGGCCGCCCGCTCTTCGCCGCCAGCGACATCAACCGCTTCTACCTCGACAAC
GGCCCACTCATCTTCCCACAAAAGAGGTGCGGCATGGCGGCGGCCATGGCGGCGCTGACG
AGGCCGAGGTACAACGGCAAGTACCTGCAGGGGAAGATCAGGAAGATGCTGGGCGAGACG
AGGGTGCGCGACACGCTGACGAACGTCGTCATCCCCACGTTCGACGTCAGGCTGCTCCAG
CCAACCATCTTCTCCACATACGACGCGAAGAGCATGCCGCTCAAGAACGCGCTCCTCTCC
GACATCTGCATCAGCACATCCGCGGCGCCGACCTACCTCCCCGCGCACTGCTTCCAGACC
ACCGACGACGCCACCGGCAAGGTCCGCGAGTTCGACCTCATCGACGGCGGCGTCGCCGCC
AACAACCCGACGATGGTGGCCATGACGCAGATCACCAAGAAGATAATGGTGAAGGACAAG
GAGGAGCTGTACCCGGTAAAGCCGTCGGACTGCGGTAAGTTCCTGGTGCTGTCCGTGGGC
ACCGGGTCGACGTCGGACCAGGGGATGTACACGGCGAGGCAGTGCTCGCGGTGGGGGATC
GTCCGGTGGCTGCGCAACAAGGGGATGGCGCCCATCATCGACATCTTCATGGCGGCCAGC
TCCGACCTCGTCGACATCCACGCCGCCGTCATGTTCCAGTCGCTGCACAGCGACGGCGAC
TACCTCCGCATCCAGGACAACACGCTCCACGGCGACGCCGCCACGGTGGACGCCGCCACC
AGGGACAACATGCGGGCGCTCGTCGGGATCGGCGAGCGGATGCTGGCGCAGCGGGTGTCG
AGGGTCAACGTCGAGACCGGCAGGTACGTCGAGGTGCCCGGCGCCGGCAGCAACGCCGAC
GCGCTGAGGGGCTTCGCCAGGCAGCTCTCCGAGGAGAGGAGGGCGAGGCTAGGTCGGCGA
AACGCCTGCGGCGGCGGCGGCGAAGGAGAGCCCAGCGGCGTGGCGTGCAAGCGTTAGTAA
CTGTACACGCATCATGCTGACGCGATCTTTTTTATTTTTCTTTTTTTTTTTTTACCTTTC
TAGCGGACATGGGGAATAACAAGACGTGACAGTAGTGCAATCGGTTTGTAACGTGCGTAT
ACCAACATTGATCCATTTCTTCATC

CDS

1299 bp

>Os03t0393900-01 Pollen-specific phospholipase, Patatin like phospholipase A, Pollen viability
ATGGCGGCGAGCTACTCGTGCCGGCGGACATGCGAGGCGTGCAGCACGAGGGCGATGGCC
GGGTGCGTGGTGGGCGAGCCGGCGTCGGCGCCGGGGCAGCGGGTGACGTTGCTGGCGATC
GACGGCGGCGGCATCAGGGGCCTCATCCCGGGCACCATCCTCGCCTTCCTCGAGGCCAGG
CTGCAGGAGCTGGATGGCCCCGACGCGCGCCTCGCCGATTACTTCGACTGCATCGCCGGG
ACCAGCACCGGCGGCCTCATCACCGCCATGCTCGCCGCGCCCGGCGACCACGGCCGCCCG
CTCTTCGCCGCCAGCGACATCAACCGCTTCTACCTCGACAACGGCCCACTCATCTTCCCA
CAAAAGAGGTGCGGCATGGCGGCGGCCATGGCGGCGCTGACGAGGCCGAGGTACAACGGC
AAGTACCTGCAGGGGAAGATCAGGAAGATGCTGGGCGAGACGAGGGTGCGCGACACGCTG
ACGAACGTCGTCATCCCCACGTTCGACGTCAGGCTGCTCCAGCCAACCATCTTCTCCACA
TACGACGCGAAGAGCATGCCGCTCAAGAACGCGCTCCTCTCCGACATCTGCATCAGCACA
TCCGCGGCGCCGACCTACCTCCCCGCGCACTGCTTCCAGACCACCGACGACGCCACCGGC
AAGGTCCGCGAGTTCGACCTCATCGACGGCGGCGTCGCCGCCAACAACCCGACGATGGTG
GCCATGACGCAGATCACCAAGAAGATAATGGTGAAGGACAAGGAGGAGCTGTACCCGGTA
AAGCCGTCGGACTGCGGTAAGTTCCTGGTGCTGTCCGTGGGCACCGGGTCGACGTCGGAC
CAGGGGATGTACACGGCGAGGCAGTGCTCGCGGTGGGGGATCGTCCGGTGGCTGCGCAAC
AAGGGGATGGCGCCCATCATCGACATCTTCATGGCGGCCAGCTCCGACCTCGTCGACATC
CACGCCGCCGTCATGTTCCAGTCGCTGCACAGCGACGGCGACTACCTCCGCATCCAGGAC
AACACGCTCCACGGCGACGCCGCCACGGTGGACGCCGCCACCAGGGACAACATGCGGGCG
CTCGTCGGGATCGGCGAGCGGATGCTGGCGCAGCGGGTGTCGAGGGTCAACGTCGAGACC
GGCAGGTACGTCGAGGTGCCCGGCGCCGGCAGCAACGCCGACGCGCTGAGGGGCTTCGCC
AGGCAGCTCTCCGAGGAGAGGAGGGCGAGGCTAGGTCGGCGAAACGCCTGCGGCGGCGGC
GGCGAAGGAGAGCCCAGCGGCGTGGCGTGCAAGCGTTAG

Protein

433 aa

>Os03t0393900-01 Pollen-specific phospholipase, Patatin like phospholipase A, Pollen viability
MAASYSCRRTCEACSTRAMAGCVVGEPASAPGQRVTLLAIDGGGIRGLIPGTILAFLEAR
LQELDGPDARLADYFDCIAGTSTGGLITAMLAAPGDHGRPLFAASDINRFYLDNGPLIFP
QKRCGMAAAMAALTRPRYNGKYLQGKIRKMLGETRVRDTLTNVVIPTFDVRLLQPTIFST
YDAKSMPLKNALLSDICISTSAAPTYLPAHCFQTTDDATGKVREFDLIDGGVAANNPTMV
AMTQITKKIMVKDKEELYPVKPSDCGKFLVLSVGTGSTSDQGMYTARQCSRWGIVRWLRN
KGMAPIIDIFMAASSDLVDIHAAVMFQSLHSDGDYLRIQDNTLHGDAATVDAATRDNMRA
LVGIGERMLAQRVSRVNVETGRYVEVPGAGSNADALRGFARQLSEERRARLGRRNACGGG
GEGEPSGVACKR*

5'UTR

chr03:15836613..15836690 (+ strand) : 78 bp

CDS

chr03:15836691..15837055 (+ strand) : 365 bp

chr03:15837148..15837328 (+ strand) : 181 bp

chr03:15837415..15837579 (+ strand) : 165 bp

chr03:15837687..15838274 (+ strand) : 588 bp

3'UTR

chr03:15838275..15838422 (+ strand) : 148 bp

FASTA

>Os03t0393900-01 class=Sequence position=chr03:15836613..15838422 (+ strand)
ACAGTGACTA GTGACAAACG ATCGATCGAT CCCTCCATCC ACAAACCCTC CTCGATCTCA TCTTCCTTCG TCTCGTCAAT
GGCGGCGAGC TACTCGTGCC GGCGGACATG CGAGGCGTGC AGCACGAGGG CGATGGCCGG GTGCGTGGTG GGCGAGCCGG
CGTCGGCGCC GGGGCAGCGG GTGACGTTGC TGGCGATCGA CGGCGGCGGC ATCAGGGGCC TCATCCCGGG CACCATCCTC
GCCTTCCTCG AGGCCAGGCT GCAGGAGCTG GATGGCCCCG ACGCGCGCCT CGCCGATTAC TTCGACTGCA TCGCCGGGAC
CAGCACCGGC GGCCTCATCA CCGCCATGCT CGCCGCGCCC GGCGACCACG GCCGCCCGCT CTTCGCCGCC AGCGACATCA
ACCGCTTCTA CCTCGACAAC GGCCCACTCA TCTTCCCACA AAAGTAACTG ATCACCTCGA ATTCGATCTC CTCTCTTCGA
TCTCTGCATT ATTTGATTTG ATTGGGGATT GTGGGCGGCG TGGCGTGGCG TCCAGGAGGT GCGGCATGGC GGCGGCCATG
GCGGCGCTGA CGAGGCCGAG GTACAACGGC AAGTACCTGC AGGGGAAGAT CAGGAAGATG CTGGGCGAGA CGAGGGTGCG
CGACACGCTG ACGAACGTCG TCATCCCCAC GTTCGACGTC AGGCTGCTCC AGCCAACCAT CTTCTCCACA TACGACGTGC
GTGCGTTGAT TCCATCCGCA TTGGCGTTGG AATCAGCTGA TTGTTTGATT GATCGAACAA TTGATCGGTT AAAATTTTGC
AGGCGAAGAG CATGCCGCTC AAGAACGCGC TCCTCTCCGA CATCTGCATC AGCACATCCG CGGCGCCGAC CTACCTCCCC
GCGCACTGCT TCCAGACCAC CGACGACGCC ACCGGCAAGG TCCGCGAGTT CGACCTCATC GACGGCGGCG TCGCCGCCAA
CAACCCGGTA ACTAATCAAT CAAGCAATCC ATCAAACGAA GATCCACATG TGCATTCCTG TGGTACAAAT GCTGATCGAT
CGATGGATGG ATCGATTTTC GCGAGAACGT ACAGACGATG GTGGCCATGA CGCAGATCAC CAAGAAGATA ATGGTGAAGG
ACAAGGAGGA GCTGTACCCG GTAAAGCCGT CGGACTGCGG TAAGTTCCTG GTGCTGTCCG TGGGCACCGG GTCGACGTCG
GACCAGGGGA TGTACACGGC GAGGCAGTGC TCGCGGTGGG GGATCGTCCG GTGGCTGCGC AACAAGGGGA TGGCGCCCAT
CATCGACATC TTCATGGCGG CCAGCTCCGA CCTCGTCGAC ATCCACGCCG CCGTCATGTT CCAGTCGCTG CACAGCGACG
GCGACTACCT CCGCATCCAG GACAACACGC TCCACGGCGA CGCCGCCACG GTGGACGCCG CCACCAGGGA CAACATGCGG
GCGCTCGTCG GGATCGGCGA GCGGATGCTG GCGCAGCGGG TGTCGAGGGT CAACGTCGAG ACCGGCAGGT ACGTCGAGGT
GCCCGGCGCC GGCAGCAACG CCGACGCGCT GAGGGGCTTC GCCAGGCAGC TCTCCGAGGA GAGGAGGGCG AGGCTAGGTC
GGCGAAACGC CTGCGGCGGC GGCGGCGAAG GAGAGCCCAG CGGCGTGGCG TGCAAGCGTT AGTAACTGTA CACGCATCAT
GCTGACGCGA TCTTTTTTAT TTTTCTTTTT TTTTTTTTAC CTTTCTAGCG GACATGGGGA ATAACAAGAC GTGACAGTAG
TGCAATCGGT TTGTAACGTG CGTATACCAA CATTGATCCA TTTCTTCATC