Os03t0395000-01

Locus

Os03g0395000

Description

Stroma-localized heme oxygenase 2, Tetrapyrrole biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsHO2, HO2, YLC2

RAP-DB Gene Name Synonym(s)

heme oxgenase 2, heme oxygenase-2, Young Leaf Chlorosis 2

CGSNL Gene Symbol

YLC2

CGSNL Gene Name

YOUNG LEAF CHLOROSIS 2

Oryzabase Gene Symbol Synonym(s)

OsHO2, HO2, OsHO-2, HO-2

Oryzabase Gene Name Synonym(s)

heme oxgenase 2, heme oxygenase-2, Young Leaf Chlorosis 2

Transcript Evidence

AK073283

Protein Evidence

Q10K62

Literature

PMID: 25037719

Note

Manual Curation

December 5, 2016

Gene Ontology (GO)

Biological Process: heme oxidation (GO:0006788)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: heme oxygenase (decyclizing) activity (GO:0004392)

Functional domain (InterPro)

Haem oxygenase (decyclizing), plant (IPR016951)

Haem oxygenase-like (IPR016053)

Haem oxygenase-like, multi-helical (IPR016084)

Full-length cDNA

J033029D12 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0395000-01)

RiceXPro (AK073283)

Others

Oryzabase (12121)

KEGG (Os03t0395000-01)

Transcript

1573 bp

>Os03t0395000-01 Stroma-localized heme oxygenase 2, Tetrapyrrole biosynthesis
GCCGTGCAGGATGCCCGAGTGGATAACCCGTTAAACCCCCCGATGCCGCTCGCCGCCGCC
GTCGCCGCCTCGGCGGTCGTGCCGCCGCGGCCGCCTCCTCCGCCGCCGCGGAGAGCGCGG
CCCTTGCGCTCCTTTACTGGACTAATACTAACGAGGGACCTAGCAGCCCTAACGGTGGCC
CGCTGCGCTCCCTCCCCTCCTGCCCCCGCGGCGGAGGCGGAGGCGGAGGCGGTGGCGGTG
GATGAGGCGCCGCCAGCGAAGCCGCGGCCGCGGCGGTACCCGAGGCAGTACCCCGGCGAG
GCGGTGGGCGTCGCCGAGGAGATGCGGTTCGTCGCCATGCGCCTCCGGAACCCCAAGCGG
ACCACCCTCAAGATGGACGATACGGGGGCCGAGGAGGAGGTGGGCGATGGCGTCAGTGAG
GATGCGTCGGCGTCAGAGGAGGAGGAGGAGGAGGAGGACGACGACGACGTGGTTGAGGAG
GAGGAGGAGGGAGCGGGGTTGGAGGGGGAGTGGATGCCGAGCATGGAGGGGTTCGTCAAG
TACCTGGTGGACAGCAAGCTCGTCTTCGACACCGTCGAGCGGATCGTAGCCGAGTCCACC
GACGTCGCCTATGTTTACTTCAGGAAAAGTGGTCTGGAACGCTCAGCTAGAATTACAAAA
GATTTGGAGTGGTTTGGAGGGCAAGGAATTGCAGTACCAGAGCCAAGTACTGCTGGATCA
ACATATGCAACTTATCTGACTGAACTTGCTGAGAGCAATGCCCCAGCCTTCCTTTCCCAC
TATTACAATATTTATTTTGCACATACAACTGGAGGGGTGGCTATAGGTAACAAGATATCC
AAGAAAATTTTGGAAGGAAGGGAGCTAGAGTTTTACAAATGGGATTCTGATGTAGAACTT
TTGCTAAAAGATACCAGGGAGAAGCTTAACGAACTTAGCAAGCATTGGTCTCGGAAGGAC
AGGAACTTGTGCTTGAAAGAAGCTGCAAAATGTTTCCAGCATTTGGGGCGGATTGTTCGC
TTAATCATCTTATAGTTCCTCATAGATGAGCAACTGATCAAATCAACCTATAATCTATTC
CTGAAGACAGGAAAGCTAGAGATATATTAAACTTGAGGCTTAGTGCAGTCATTTTTGTCG
AAGACTACACGTCTTAACTATGTTGAAGTCTGGTACAGAAGGATCTTCTGGTGTGAGACT
GAAGCTGATCAGCGAGCACTATCCTGGAGATTGAAAACACCAGGCCACAACAATAGCCTC
TTTTCTGGCTTGCATGGTGGAGCTGCTCGTTGGAGTGAGCTCTTGCTTTCAGCAACTTCG
AACTGTGCAAAGTTGAAGATGCTTGCTGCTGTCGATCAGGATCTCACGCGTTCAATCGCA
ATGATGCCAGCCTGACACAATTCACTTAGCAGCAGAACACCATGCTAGCCAGCCAGGATC
CCCCCATGCCTGCCAAAGCTTCGTCTCCTCTTGTACCTCACCACATTATCCATTTATCCT
TGCAATGAATTCGCTTTGCTTGTACCAATCCTAGCTACTACTACTACTACCATCTTACAT
TATCCTTGCAATC

CDS

993 bp

>Os03t0395000-01 Stroma-localized heme oxygenase 2, Tetrapyrrole biosynthesis
ATGCCGCTCGCCGCCGCCGTCGCCGCCTCGGCGGTCGTGCCGCCGCGGCCGCCTCCTCCG
CCGCCGCGGAGAGCGCGGCCCTTGCGCTCCTTTACTGGACTAATACTAACGAGGGACCTA
GCAGCCCTAACGGTGGCCCGCTGCGCTCCCTCCCCTCCTGCCCCCGCGGCGGAGGCGGAG
GCGGAGGCGGTGGCGGTGGATGAGGCGCCGCCAGCGAAGCCGCGGCCGCGGCGGTACCCG
AGGCAGTACCCCGGCGAGGCGGTGGGCGTCGCCGAGGAGATGCGGTTCGTCGCCATGCGC
CTCCGGAACCCCAAGCGGACCACCCTCAAGATGGACGATACGGGGGCCGAGGAGGAGGTG
GGCGATGGCGTCAGTGAGGATGCGTCGGCGTCAGAGGAGGAGGAGGAGGAGGAGGACGAC
GACGACGTGGTTGAGGAGGAGGAGGAGGGAGCGGGGTTGGAGGGGGAGTGGATGCCGAGC
ATGGAGGGGTTCGTCAAGTACCTGGTGGACAGCAAGCTCGTCTTCGACACCGTCGAGCGG
ATCGTAGCCGAGTCCACCGACGTCGCCTATGTTTACTTCAGGAAAAGTGGTCTGGAACGC
TCAGCTAGAATTACAAAAGATTTGGAGTGGTTTGGAGGGCAAGGAATTGCAGTACCAGAG
CCAAGTACTGCTGGATCAACATATGCAACTTATCTGACTGAACTTGCTGAGAGCAATGCC
CCAGCCTTCCTTTCCCACTATTACAATATTTATTTTGCACATACAACTGGAGGGGTGGCT
ATAGGTAACAAGATATCCAAGAAAATTTTGGAAGGAAGGGAGCTAGAGTTTTACAAATGG
GATTCTGATGTAGAACTTTTGCTAAAAGATACCAGGGAGAAGCTTAACGAACTTAGCAAG
CATTGGTCTCGGAAGGACAGGAACTTGTGCTTGAAAGAAGCTGCAAAATGTTTCCAGCAT
TTGGGGCGGATTGTTCGCTTAATCATCTTATAG

Protein

331 aa

>Os03t0395000-01 Stroma-localized heme oxygenase 2, Tetrapyrrole biosynthesis
MPLAAAVAASAVVPPRPPPPPPRRARPLRSFTGLILTRDLAALTVARCAPSPPAPAAEAE
AEAVAVDEAPPAKPRPRRYPRQYPGEAVGVAEEMRFVAMRLRNPKRTTLKMDDTGAEEEV
GDGVSEDASASEEEEEEEDDDDVVEEEEEGAGLEGEWMPSMEGFVKYLVDSKLVFDTVER
IVAESTDVAYVYFRKSGLERSARITKDLEWFGGQGIAVPEPSTAGSTYATYLTELAESNA
PAFLSHYYNIYFAHTTGGVAIGNKISKKILEGRELEFYKWDSDVELLLKDTREKLNELSK
HWSRKDRNLCLKEAAKCFQHLGRIVRLIIL*

5'UTR

chr03:15927393..15927434 (- strand) : 42 bp

CDS

chr03:15926825..15927392 (- strand) : 568 bp

chr03:15925769..15925992 (- strand) : 224 bp

chr03:15924818..15924925 (- strand) : 108 bp

chr03:15924613..15924705 (- strand) : 93 bp

3'UTR

chr03:15924075..15924612 (- strand) : 538 bp

FASTA

>Os03t0395000-01 class=Sequence position=chr03:15924075..15927434 (- strand)
GCCGTGCAGG ATGCCCGAGT GGATAACCCG TTAAACCCCC CGATGCCGCT CGCCGCCGCC GTCGCCGCCT CGGCGGTCGT
GCCGCCGCGG CCGCCTCCTC CGCCGCCGCG GAGAGCGCGG CCCTTGCGCT CCTTTACTGG ACTAATACTA ACGAGGGACC
TAGCAGCCCT AACGGTGGCC CGCTGCGCTC CCTCCCCTCC TGCCCCCGCG GCGGAGGCGG AGGCGGAGGC GGTGGCGGTG
GATGAGGCGC CGCCAGCGAA GCCGCGGCCG CGGCGGTACC CGAGGCAGTA CCCCGGCGAG GCGGTGGGCG TCGCCGAGGA
GATGCGGTTC GTCGCCATGC GCCTCCGGAA CCCCAAGCGG ACCACCCTCA AGATGGACGA TACGGGGGCC GAGGAGGAGG
TGGGCGATGG CGTCAGTGAG GATGCGTCGG CGTCAGAGGA GGAGGAGGAG GAGGAGGACG ACGACGACGT GGTTGAGGAG
GAGGAGGAGG GAGCGGGGTT GGAGGGGGAG TGGATGCCGA GCATGGAGGG GTTCGTCAAG TACCTGGTGG ACAGCAAGCT
CGTCTTCGAC ACCGTCGAGC GGATCGTAGC CGAGTCCACC GACGTCGCCT GTGAGTTGCG ATTCCTACTC TCCAAATCCC
CGCCTTCCCA ATGCAATTAG AATATCCTAA TTCAATGTTG TTCCTTAATC AGCTTAGTCT TCAGTTTCCA ATGCAATTGG
AATCTCCTAA TTTTTCAGGA ATTATAGATT TAGAATATGA CATATTGACT TGTTGGTAGG ATGGTAAAAT GTGTCGGTAA
GAACATGTTT GGGGGATACA AGCTAGGTGG TAGGAATTCC ATTTTTAGTG CTCACTTGGG TATGCGGCGA AGGTTGCAAT
TATTTTGGCA ATATGCAAGG TTGAAATTTA AGGTTGTGAT TATTTTGATG GAACTTGATG CATGGTGTGA AGTCGTGGCG
TGAAATGAAA ATTGTATGGA TTACAATTTT GGAAGGCATT TACTGCCAAA TGGTGGAAGA TGCACTTTAG CACAATACAT
GTTCTGCGTG TGCAGCAATC ATCCTACGGC TGAATCTCCT TTAGTGGTGC ACCGTGAAAG AAATGATCTT TTGGGATGTT
CTGGAGTATA GATGGCAGAC CATATTGGTA ATGAAGCACA TTGCTGGCAT CATGCATCAT AGTGTACTTG AGCATCTCCG
CGAAGATCTC CGCATCGATT TTTGTCAGTG ATATTGTTTT CTGACAACTT AATTAGTGTG AGACACCAAC CATGTTGCCT
AGAATGCTTG CCAAATTGAA TTGTTCAGCA CTCGGTAGTA TATGCTACAT ACTTTTACGT ATGGCTCTTT AGGGGCATTC
AGTACCTCTG TTTGGAACTT TGTTCAATCA CTGCAACAGA AACTGCAGTT ACTTACATAT CATTTATGCA ATTTTCATTC
AGATGTTTAC TTCAGGAAAA GTGGTCTGGA ACGCTCAGCT AGAATTACAA AAGATTTGGA GTGGTTTGGA GGGCAAGGAA
TTGCAGTACC AGAGCCAAGT ACTGCTGGAT CAACATATGC AACTTATCTG ACTGAACTTG CTGAGAGCAA TGCCCCAGCC
TTCCTTTCCC ACTATTACAA TATTTATTTT GCACATACAA CTGGAGGGGT GGCTATAGGT AACAAGGTAA TGCTATTCCC
ATATTGGATT TAAGTCCCCA TTAAGTTGTG TAATGAACTG TTGatatata tactcatgtt tcatacctaa cctgattaaa
tatccattat atgtctatta aactataaAC AAAATATAAA CCAGCAGATT TAAATGAAAT ACTGAGTTCA ACGCTACTTT
CTTATCAGAT GAGATGATAC ATTGTGATTT CATTGTTTCA TGTCTCAACA TGTTTCTCAT TAAATGGATT GGCAGCACGG
AGCTTTTTGT ATGGAGTTGA CAAAAGAGTG TAAAGCTGAA TATCTAGACT GATACATTTC TATTCTGGGT ATCAGATATT
CATATATAAA GTTCCTCTGT TAGCTGGTGA TACAGGGCTA TTTAAACATT TGGTTTCTAT TTTCCTTTGA TGTAGCAGCT
TGTGGCCAAA ATTGCTACCA AATCCACCAA AATATGGCAT TGCCAAAGTT TAGTGATGGA TTTGCGAATC AACATTTTGG
CTAGACATTG ACATCCATTG GCTCCAACCA AACAGCCTTA TAATAGCAAA GAATCTTCTT AAACAAGAAT AGAGAGATAG
TTGCTTTGTT CTCCCCATCT CTTTTGTGAT TTTGAGCTCA CCTGCATGCC CTCTTAACCT TTTTGAGCGA AATACAAGTT
CTGTTTAAGC TTTCATATTT CCCCTAAATT CTCTTCACAC TTGCACCATC ATAATAATGA TGCTAGATAA TTTGTTCAGT
ATAAAGGCAA GTTTACTTTG TAGTTTGTAT TATTACAACT CTGTAAGTTC TTTGAAAACA AAATTTATTT AATTGCTCTC
TGAAGAAGTA TTAGTTTGAA ACGTAACAGA TATCCAAGAA AATTTTGGAA GGAAGGGAGC TAGAGTTTTA CAAATGGGAT
TCTGATGTAG AACTTTTGCT AAAAGATACC AGGGAGAAGC TTAACGAACT TAGCAAGGTA ACCGCCTCAA GATCACTTTC
TTTTATTTTC TTGTAAGCTC GAAACTGGAA TTTGCCACAG AAGTTATATG CTTATGTAAC CTGATTAGTC TATCTGTCAT
GCTGTCCAGC ATTGGTCTCG GAAGGACAGG AACTTGTGCT TGAAAGAAGC TGCAAAATGT TTCCAGCATT TGGGGCGGAT
TGTTCGCTTA ATCATCTTAT AGTTCCTCAT AGATGAGCAA CTGATCAAAT CAACCTATAA TCTATTCCTG AAGACAGGAA
AGCTAGAGAT ATATTAAACT TGAGGCTTAG TGCAGTCATT TTTGTCGAAG ACTACACGTC TTAACTATGT TGAAGTCTGG
TACAGAAGGA TCTTCTGGTG TGAGACTGAA GCTGATCAGC GAGCACTATC CTGGAGATTG AAAACACCAG GCCACAACAA
TAGCCTCTTT TCTGGCTTGC ATGGTGGAGC TGCTCGTTGG AGTGAGCTCT TGCTTTCAGC AACTTCGAAC TGTGCAAAGT
TGAAGATGCT TGCTGCTGTC GATCAGGATC TCACGCGTTC AATCGCAATG ATGCCAGCCT GACACAATTC ACTTAGCAGC
AGAACACCAT GCTAGCCAGC CAGGATCCCC CCATGCCTGC CAAAGCTTCG TCTCCTCTTG TACCTCACCA CATTATCCAT
TTATCCTTGC AATGAATTCG CTTTGCTTGT ACCAATCCTA GCTACTACTA CTACTACCAT CTTACATTAT CCTTGCAATC

Locus: Os03g0395000

Loading...

Locus: Os03g0395000

Loading...