Os03t0395000-02

Locus

Os03g0395000

Description

Similar to Heme oxygenase 2 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YLC2

CGSNL Gene Name

YOUNG LEAF CHLOROSIS 2

Oryzabase Gene Symbol Synonym(s)

OsHO2, HO2, OsHO-2, HO-2

Oryzabase Gene Name Synonym(s)

heme oxgenase 2, heme oxygenase-2, Young Leaf Chlorosis 2

Transcript Evidence

AK061587 (DDBJ, Best hit)

Protein Evidence

Q94FW8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: heme oxidation (GO:0006788)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: heme oxygenase (decyclizing) activity (GO:0004392)

Functional domain (InterPro)

Haem oxygenase (IPR002051)

Haem oxygenase-like, multi-helical (IPR016084)

Full-length cDNA

001-020-F06 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0395000-02)

RiceXPro (AK061587)

Others

Oryzabase (12121)

KEGG (Os03t0395000-02)

Transcript

882 bp

>Os03t0395000-02 Similar to Heme oxygenase 2 (Fragment).
ATTGCAGTACCAGAGCCAAGTACTGCTGGATCAACATATGCAACTTATCTGACTGAACTT
GCTGAGAGCAATGCCCCAGCCTTCCTTTCCCACTATTACAATATTTATTTTGCACATACA
ACTGGAGGGGTGGCTATAGGTAACAAGATATCCAAGAAAATTTTGGAAGGAAGGGAGCTA
GAGTTTTACAAATGGGATTCTGATGTAGAACTTTTGCTAAAAGATACCAGGGAGAAGCTT
AACGAACTTAGCAAGCATTGGTCTCGGAAGGACAGGAACTTGTGCTTGAAAGAAGCTGCA
AAATGTTTCCAGCATTTGGGGCGGATTGTTCGCTTAATCATCTTATAGTTCCTCATAGAT
GAGCAACTGATCAAATCAACCTATAATCTATTCCTGAAGACAGGAAAGCTAGAGATATAT
TAAACTTGAGGCTTAGTGCAGTCATTTTTGTCGAAGACTACACGTCTTAACTATGTTGAA
GTCTGGTACAGAAGGATCTTCTGGTGTGAGACTGAAGCTGATCAGCGAGCACTATCCTGG
AGATTGAAAACACCAGGCCACAACAATAGCCTCTTTTCTGGCTTGCATGGTGGAGCTGCT
CGTTGGAGTGAGCTCTTGCTTTCAGCAACTTCGAACTGTGCAAAGTTGAAGATGCTTGCT
GCTGTCGATCAGGATCTCACGCGTTCAATCGCAATGATGCCAGCCTGACACAATTCACTT
AGCAGCAGAACACCATGCTAGCCAGCCAGGATCCCCCCATGCCTGCCAAAGCTTCGTCTC
CTCTTGTACCTCACCACATTATCCATTTATCCTTGCAATGAATTCGCTTTGCTTGTACCA
ATCCTAGCTACTACTACTACTACCATCTTACATTATCCTTGC

CDS

348 bp

>Os03t0395000-02 Similar to Heme oxygenase 2 (Fragment).
ATTGCAGTACCAGAGCCAAGTACTGCTGGATCAACATATGCAACTTATCTGACTGAACTT
GCTGAGAGCAATGCCCCAGCCTTCCTTTCCCACTATTACAATATTTATTTTGCACATACA
ACTGGAGGGGTGGCTATAGGTAACAAGATATCCAAGAAAATTTTGGAAGGAAGGGAGCTA
GAGTTTTACAAATGGGATTCTGATGTAGAACTTTTGCTAAAAGATACCAGGGAGAAGCTT
AACGAACTTAGCAAGCATTGGTCTCGGAAGGACAGGAACTTGTGCTTGAAAGAAGCTGCA
AAATGTTTCCAGCATTTGGGGCGGATTGTTCGCTTAATCATCTTATAG

Protein

116 aa

>Os03t0395000-02 Similar to Heme oxygenase 2 (Fragment).
IAVPEPSTAGSTYATYLTELAESNAPAFLSHYYNIYFAHTTGGVAIGNKISKKILEGREL
EFYKWDSDVELLLKDTREKLNELSKHWSRKDRNLCLKEAAKCFQHLGRIVRLIIL*

CDS

chr03:15925769..15925915 (- strand) : 147 bp

chr03:15924818..15924925 (- strand) : 108 bp

chr03:15924613..15924705 (- strand) : 93 bp

3'UTR

chr03:15924079..15924612 (- strand) : 534 bp

FASTA

>Os03t0395000-02 class=Sequence position=chr03:15924079..15925915 (- strand)
ATTGCAGTAC CAGAGCCAAG TACTGCTGGA TCAACATATG CAACTTATCT GACTGAACTT GCTGAGAGCA ATGCCCCAGC
CTTCCTTTCC CACTATTACA ATATTTATTT TGCACATACA ACTGGAGGGG TGGCTATAGG TAACAAGGTA ATGCTATTCC
CATATTGGAT TTAAGTCCCC ATTAAGTTGT GTAATGAACT GTTGatatat atactcatgt ttcataccta acctgattaa
atatccatta tatgtctatt aaactataaA CAAAATATAA ACCAGCAGAT TTAAATGAAA TACTGAGTTC AACGCTACTT
TCTTATCAGA TGAGATGATA CATTGTGATT TCATTGTTTC ATGTCTCAAC ATGTTTCTCA TTAAATGGAT TGGCAGCACG
GAGCTTTTTG TATGGAGTTG ACAAAAGAGT GTAAAGCTGA ATATCTAGAC TGATACATTT CTATTCTGGG TATCAGATAT
TCATATATAA AGTTCCTCTG TTAGCTGGTG ATACAGGGCT ATTTAAACAT TTGGTTTCTA TTTTCCTTTG ATGTAGCAGC
TTGTGGCCAA AATTGCTACC AAATCCACCA AAATATGGCA TTGCCAAAGT TTAGTGATGG ATTTGCGAAT CAACATTTTG
GCTAGACATT GACATCCATT GGCTCCAACC AAACAGCCTT ATAATAGCAA AGAATCTTCT TAAACAAGAA TAGAGAGATA
GTTGCTTTGT TCTCCCCATC TCTTTTGTGA TTTTGAGCTC ACCTGCATGC CCTCTTAACC TTTTTGAGCG AAATACAAGT
TCTGTTTAAG CTTTCATATT TCCCCTAAAT TCTCTTCACA CTTGCACCAT CATAATAATG ATGCTAGATA ATTTGTTCAG
TATAAAGGCA AGTTTACTTT GTAGTTTGTA TTATTACAAC TCTGTAAGTT CTTTGAAAAC AAAATTTATT TAATTGCTCT
CTGAAGAAGT ATTAGTTTGA AACGTAACAG ATATCCAAGA AAATTTTGGA AGGAAGGGAG CTAGAGTTTT ACAAATGGGA
TTCTGATGTA GAACTTTTGC TAAAAGATAC CAGGGAGAAG CTTAACGAAC TTAGCAAGGT AACCGCCTCA AGATCACTTT
CTTTTATTTT CTTGTAAGCT CGAAACTGGA ATTTGCCACA GAAGTTATAT GCTTATGTAA CCTGATTAGT CTATCTGTCA
TGCTGTCCAG CATTGGTCTC GGAAGGACAG GAACTTGTGC TTGAAAGAAG CTGCAAAATG TTTCCAGCAT TTGGGGCGGA
TTGTTCGCTT AATCATCTTA TAGTTCCTCA TAGATGAGCA ACTGATCAAA TCAACCTATA ATCTATTCCT GAAGACAGGA
AAGCTAGAGA TATATTAAAC TTGAGGCTTA GTGCAGTCAT TTTTGTCGAA GACTACACGT CTTAACTATG TTGAAGTCTG
GTACAGAAGG ATCTTCTGGT GTGAGACTGA AGCTGATCAG CGAGCACTAT CCTGGAGATT GAAAACACCA GGCCACAACA
ATAGCCTCTT TTCTGGCTTG CATGGTGGAG CTGCTCGTTG GAGTGAGCTC TTGCTTTCAG CAACTTCGAA CTGTGCAAAG
TTGAAGATGC TTGCTGCTGT CGATCAGGAT CTCACGCGTT CAATCGCAAT GATGCCAGCC TGACACAATT CACTTAGCAG
CAGAACACCA TGCTAGCCAG CCAGGATCCC CCCATGCCTG CCAAAGCTTC GTCTCCTCTT GTACCTCACC ACATTATCCA
TTTATCCTTG CAATGAATTC GCTTTGCTTG TACCAATCCT AGCTACTACT ACTACTACCA TCTTACATTA TCCTTGC

Locus: Os03g0395000

Loading...

Locus: Os03g0395000

Loading...