Os03t0396500-00

Locus

Os03g0396500

Description

Tify domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TIFY11G

CGSNL Gene Name

TIFY GENE 11G

Oryzabase Gene Symbol Synonym(s)

OsJAZ 15, OsJAZ15, OsTIFY11g

Oryzabase Gene Name Synonym(s)

Jasmonate ZIM-domain protein 15

Transcript Evidence

FP093276 (DDBJ)

Protein Evidence

NP_001173460.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tify (IPR010399)

CO/COL/TOC1, conserved site (IPR018467)

Expression Databases

TENOR (Os03t0396500-00)

Others

Oryzabase (15071)

Transcript

528 bp

>Os03t0396500-00 Tify domain containing protein.
TACGTTCAAGGAGGAGAAAGGCCGGACGCGAGAGATGGACGCCGTCGGCGCAGCTGGCGG
TGGCGCCATGCTCCCCGCCGCCGCCAGGCGCGGCCAGCCGCCGCAGCCACCGTGCATGAC
GACGGCGCCGGAGCAGCAGGCCGCCGCCGGAGGCGCCGTGATCTGGCCGGCGGCGGCGGC
GGCGGAGGCCAAGGAGAAGATGGTCGTCGACGCCCGGACCATGCAGCTCTTCCCCACGCG
ATCCGCAGACGGCTGCATGTGACGCCGTCGGTGCCGGCGACGGCGCCGACGGCGCCATTG
ACCATCGTCTACGGCGGCCAGGTGCTGGTGTTCGAGCACTACACGGCGGAGGCGGCCGAG
AAGCTGGTGCAGCGCACGCAGCATCTGACTCCCCCGCCGGACGAGCCGCCCATGCTGCTG
CCGCCGCCGCAGATGCCGGCTGCCTCGGGGGTCTCCGCCGGCGGCGTGATGCCGATCGCC
AGGAAGGCGTCGCTGCAGCGATTCCTCCAAAAGAGGAAGCAAAAGTGA

CDS

528 bp

>Os03t0396500-00 Tify domain containing protein.
TACGTTCAAGGAGGAGAAAGGCCGGACGCGAGAGATGGACGCCGTCGGCGCAGCTGGCGG
TGGCGCCATGCTCCCCGCCGCCGCCAGGCGCGGCCAGCCGCCGCAGCCACCGTGCATGAC
GACGGCGCCGGAGCAGCAGGCCGCCGCCGGAGGCGCCGTGATCTGGCCGGCGGCGGCGGC
GGCGGAGGCCAAGGAGAAGATGGTCGTCGACGCCCGGACCATGCAGCTCTTCCCCACGCG
ATCCGCAGACGGCTGCATGTGACGCCGTCGGTGCCGGCGACGGCGCCGACGGCGCCATTG
ACCATCGTCTACGGCGGCCAGGTGCTGGTGTTCGAGCACTACACGGCGGAGGCGGCCGAG
AAGCTGGTGCAGCGCACGCAGCATCTGACTCCCCCGCCGGACGAGCCGCCCATGCTGCTG
CCGCCGCCGCAGATGCCGGCTGCCTCGGGGGTCTCCGCCGGCGGCGTGATGCCGATCGCC
AGGAAGGCGTCGCTGCAGCGATTCCTCCAAAAGAGGAAGCAAAAGTGA

Protein

176 aa

>Os03t0396500-00 Tify domain containing protein.
YVQGGERPDARDGRRRRSWRWRHAPRRRQARPAAAATVHDDGAGAAGRRRRRRDLAGGGG
GGGQGEDGRRRPDHAALPHAIRRRLHVTPSVPATAPTAPLTIVYGGQVLVFEHYTAEAAE
KLVQRTQHLTPPPDEPPMLLPPPQMPAASGVSAGGVMPIARKASLQRFLQKRKQK*

CDS

chr03:16025672..16025924 (- strand) : 253 bp

chr03:16025387..16025520 (- strand) : 134 bp

chr03:16025189..16025329 (- strand) : 141 bp

FASTA

>Os03t0396500-00 class=Sequence position=chr03:16025189..16025924 (- strand)
TACGTTCAAG GAGGAGAAAG GCCGGACGCG AGAGATGGAC GCCGTCGGCG CAGCTGGCGG TGGCGCCATG CTCCCCGCCG
CCGCCAGGCG CGGCCAGCCG CCGCAGCCAC CGTGCATGAC GACGGCGCCG GAGCAGCAGG CCGCCGCCGG AGGCGCCGTG
ATCTGGCCGG CGGCGGCGGC GGCGGAGGCC AAGGAGAAGA TGGTCGTCGA CGCCCGGACC ATGCAGCTCT TCCCCACGCG
ATCCGCAGAC GGCGTCGTCG TGTCGCCGGC TCCGGCGCCG GCGGCGGCCC AAGAACGACG ACGGTGAACA TATATTGCAA
ATTAAAGGCC TCTTAATTTC CGGTATCGCC TAATGTACGA TCATCTCTCT TAATTTACTT GGTCGTGTAC ATGCAGGCCG
GAAGTGCATG TGACGCCGTC GGTGCCGGCG ACGGCGCCGA CGGCGCCATT GACCATCGTC TACGGCGGCC AGGTGCTGGT
GTTCGAGCAC TACACGGCGG AGGCGGCCGA GAAGCTGGTG CAGCGCACGC AGCATCTGCT GGCTGCGGCC GCCGGCGGCG
GCGGTGGGAA CAAAAACAAT AATGTCACCG TTGTGACTCC CCCGCCGGAC GAGCCGCCCA TGCTGCTGCC GCCGCCGCAG
ATGCCGGCTG CCTCGGGGGT CTCCGCCGGC GGCGTGATGC CGATCGCCAG GAAGGCGTCG CTGCAGCGAT TCCTCCAAAA
GAGGAAGCAA AAGTGA

Locus: Os03g0396500

Loading...

Locus: Os03g0396500

Loading...