Os03t0397400-01

Locus

Os03g0397400

Description

Similar to Low affinity calcium transporter CAX2 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAX2

CGSNL Gene Name

Ca(2+)/H(+) EXCHANGER 2

Oryzabase Gene Symbol Synonym(s)

OsCAX2, CAX5, OsNCX7, OsNCX7.1, OsNCX7.2, NCX7, OsVCX2, OsOSCA1.2, OSCA1.2

Oryzabase Gene Name Synonym(s)

Vacuolar cation/proton exchanger 2, Ca(2+)/H(+) exchanger 2, cation/H+ exchanger 2, Na+/Ca2+ Exchanger 7, Sodium/calcium exchanger 7, OSCA channels 1.2

Transcript Evidence

AK069928 (DDBJ, Best hit)

Protein Evidence

Q5KQN0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cation transport (GO:0006812)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: cation transmembrane transporter activity (GO:0008324)

Functional domain (InterPro)

Calcium/proton exchanger (IPR004713)

Calcium/proton exchanger superfamily (IPR004798)

Sodium/calcium exchanger membrane region (IPR004837)

Full-length cDNA

J023036P06 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0397400-01)

RiceXPro (AK069928)

Others

Oryzabase (8982)

KEGG (Os03t0397400-01)

Transcript

1997 bp

>Os03t0397400-01 Similar to Low affinity calcium transporter CAX2 (Fragment).
GTTCGTCGTCGTCGTCTCCCTCGCCGGCCGCGACGCCACGCACCAATTCTCCGATTCGTC
GAGGAGCCGAGGAGGAATCCCAGCCTCGAGTCGCGCCCCTGATCCTCCAGGCTCCATCGA
TCCGAGGAGGAGGGGCGCGCGCGGGATTCCGTCGTCGGATTGGGTTGGGTTCGCGGATGA
TGGGGGCGGAGAAGGCGGAGGGGATGGAGGAGCTGGAGCTGGAGGAGGGCGGGGGCTCGC
CGTCTCCGTCGCCGATGACGGCCGCCGGGAAGATGCAGGCGCTGGACTTCGAGCACATCG
GGTCGCTCGCCGCGGTGGCGGAGTCGCTCTCGACGGGGAGCAAGTGGCGGAGGGCGCTCA
CCAGCGTGCGCGTCGTCATCCTCCAGGCCAAGATCAACGTCCTCCTCCCCTTCGGCCCCC
TCGCCGTCATGCTCCACTACCTCTCCGCCAACCACcaaggatgggttttccttttcagct
taatcggcatcacgcccttggctgagagattgggatatgcgaccgagcagcttgctctct
acacgggtccgacaattggggggctgttgaatgctacctttggcaatgcgactgagatga
ttatctcgttgtacgcattgaaaaacgggatgatccgtgtcgtccagcaatcgctactag
gctctatactgtcaaacatgctgttggttctcggttgtgctttcttcgctgggggtcttg
tccatcccagcagggaccaggtcttcaacaaggcgtcagccgttgtaaactcaggattgc
ttttgatggctgtcttgggtctaatgtttccagcagtacttcactttacacattctgaag
tgcagtatggaaaatccgaagtttccctttcaaggtttagtagctgcatcatgcttgtgg
catatgcaagctatctgttttttcaactaaagagccagcgaagtctgtacagtccaattg
gtgaacaggaagaagaagtaactgaggatgaggaggaagaaaaggagataacacagggtg
aagctatctgttggctttttgtgttgactatttggatttcgattctctctgggtacctgg
tagacgccatacagggggcctctgaatcattaaacatgccagtggcctttattagtgtta
ttctgcttccaatcgtgggaaatgctgctgagcacgcaagtgccattatgtttgccatga
aagacaaacttgatattacacttggagttgccataggatcgtcaacacagatctccatgt
ttgtgatcccattctgtgtggtaattggctggataatgggccaacaaatggacttgaatt
ttcaactgttcgagacagcaactctttttataacagtactggtggtggcatttatgttgc
agGAAGGAACATCGAACTATTTTAAAGGCCTTATGCTTATCTTATGCTATCTCATAGTTG
CTGCGAGCTTCTTCGTACATGTTGATCCCGATTCAAGTAACAACAAGTGAAAGATCCGCA
ACAATTTGTGGAATGATAAGGGATGAGCATATTGGAATGTCAGCACTAGCAAACAGCAGT
ATTTGCAACATATCATCTGTCCGAGTCCTGATTTTTGACGGCCTATACCTGTCAGCAGTA
TCTCACACGGAGGCTTCAACTTCCGGCCTGGAGTTGCAAGGGCCCTGATGCGGCTTTTTT
AAGATAGCGACGGCATCGCCCTTTGATTGAGAACCTGTAACTTTATTATGGGATAGTGTA
ATGTGCCAAGATCACTAGTCTGTATTTGCTGAAGAAACACTTGTCGCGATTTTTGATGAT
GTTGTTGTACTGATGCCAATGAACTGGCTATAGCGTTGCAGTTCAAGGGACACTGGATAA
CTGGACTACATAGTCCATACACATTTCCAAACGGTGCCAGTTGTGCAACATGATTTGTCA
CTGCACATAATTTATTTGTCTAGGATGGGTTGCTCGTTTTTGAATGCTTGCTTGCTTATA
AGAGAACAGGTTTCTAG

CDS

1314 bp

>Os03t0397400-01 Similar to Low affinity calcium transporter CAX2 (Fragment).
ATGATGGGGGCGGAGAAGGCGGAGGGGATGGAGGAGCTGGAGCTGGAGGAGGGCGGGGGC
TCGCCGTCTCCGTCGCCGATGACGGCCGCCGGGAAGATGCAGGCGCTGGACTTCGAGCAC
ATCGGGTCGCTCGCCGCGGTGGCGGAGTCGCTCTCGACGGGGAGCAAGTGGCGGAGGGCG
CTCACCAGCGTGCGCGTCGTCATCCTCCAGGCCAAGATCAACGTCCTCCTCCCCTTCGGC
CCCCTCGCCGTCATGCTCCACTACCTCTCCGCCAACCACcaaggatgggttttccttttc
agcttaatcggcatcacgcccttggctgagagattgggatatgcgaccgagcagcttgct
ctctacacgggtccgacaattggggggctgttgaatgctacctttggcaatgcgactgag
atgattatctcgttgtacgcattgaaaaacgggatgatccgtgtcgtccagcaatcgcta
ctaggctctatactgtcaaacatgctgttggttctcggttgtgctttcttcgctgggggt
cttgtccatcccagcagggaccaggtcttcaacaaggcgtcagccgttgtaaactcagga
ttgcttttgatggctgtcttgggtctaatgtttccagcagtacttcactttacacattct
gaagtgcagtatggaaaatccgaagtttccctttcaaggtttagtagctgcatcatgctt
gtggcatatgcaagctatctgttttttcaactaaagagccagcgaagtctgtacagtcca
attggtgaacaggaagaagaagtaactgaggatgaggaggaagaaaaggagataacacag
ggtgaagctatctgttggctttttgtgttgactatttggatttcgattctctctgggtac
ctggtagacgccatacagggggcctctgaatcattaaacatgccagtggcctttattagt
gttattctgcttccaatcgtgggaaatgctgctgagcacgcaagtgccattatgtttgcc
atgaaagacaaacttgatattacacttggagttgccataggatcgtcaacacagatctcc
atgtttgtgatcccattctgtgtggtaattggctggataatgggccaacaaatggacttg
aattttcaactgttcgagacagcaactctttttataacagtactggtggtggcatttatg
ttgcagGAAGGAACATCGAACTATTTTAAAGGCCTTATGCTTATCTTATGCTATCTCATA
GTTGCTGCGAGCTTCTTCGTACATGTTGATCCCGATTCAAGTAACAACAAGTGA

Protein

438 aa

>Os03t0397400-01 Similar to Low affinity calcium transporter CAX2 (Fragment).
MMGAEKAEGMEELELEEGGGSPSPSPMTAAGKMQALDFEHIGSLAAVAESLSTGSKWRRA
LTSVRVVILQAKINVLLPFGPLAVMLHYLSANHQGWVFLFSLIGITPLAERLGYATEQLA
LYTGPTIGGLLNATFGNATEMIISLYALKNGMIRVVQQSLLGSILSNMLLVLGCAFFAGG
LVHPSRDQVFNKASAVVNSGLLLMAVLGLMFPAVLHFTHSEVQYGKSEVSLSRFSSCIML
VAYASYLFFQLKSQRSLYSPIGEQEEEVTEDEEEEKEITQGEAICWLFVLTIWISILSGY
LVDAIQGASESLNMPVAFISVILLPIVGNAAEHASAIMFAMKDKLDITLGVAIGSSTQIS
MFVIPFCVVIGWIMGQQMDLNFQLFETATLFITVLVVAFMLQEGTSNYFKGLMLILCYLI
VAASFFVHVDPDSSNNK*

5'UTR

chr03:16061184..16061359 (+ strand) : 176 bp

CDS

chr03:16061360..16061638 (+ strand) : 279 bp

chr03:16061847..16061917 (+ strand) : 71 bp

chr03:16062028..16062056 (+ strand) : 29 bp

chr03:16062147..16062343 (+ strand) : 197 bp

chr03:16062438..16062650 (+ strand) : 213 bp

chr03:16063130..16063258 (+ strand) : 129 bp

chr03:16063426..16063542 (+ strand) : 117 bp

chr03:16063630..16063683 (+ strand) : 54 bp

chr03:16063828..16063944 (+ strand) : 117 bp

chr03:16064058..16064151 (+ strand) : 94 bp

chr03:16064569..16064582 (+ strand) : 14 bp

3'UTR

chr03:16064583..16065089 (+ strand) : 507 bp

FASTA

>Os03t0397400-01 class=Sequence position=chr03:16061184..16065089 (+ strand)
GTTCGTCGTC GTCGTCTCCC TCGCCGGCCG CGACGCCACG CACCAATTCT CCGATTCGTC GAGGAGCCGA GGAGGAATCC
CAGCCTCGAG TCGCGCCCCT GATCCTCCAG GCTCCATCGA TCCGAGGAGG AGGGGCGCGC GCGGGATTCC GTCGTCGGAT
TGGGTTGGGT TCGCGGATGA TGGGGGCGGA GAAGGCGGAG GGGATGGAGG AGCTGGAGCT GGAGGAGGGC GGGGGCTCGC
CGTCTCCGTC GCCGATGACG GCCGCCGGGA AGATGCAGGC GCTGGACTTC GAGCACATCG GGTCGCTCGC CGCGGTGGCG
GAGTCGCTCT CGACGGGGAG CAAGTGGCGG AGGGCGCTCA CCAGCGTGCG CGTCGTCATC CTCCAGGCCA AGATCAACGT
CCTCCTCCCC TTCGGCCCCC TCGCCGTCAT GCTCCACTAC CTCTCCGCCA ACCACGTACT ACTATGCTGC AACCCATTTC
CTCCCCCCCC CCCCCCCTCG CTTAAGCATT TATTATTGTT TTGCTTAAAC ATTTGACTCG TTTGTGTTAA ATGCCTTGTT
AGAACCTTCC ATATGGAGAT GTCTTTTCCA TTCCATTTCC TTGTTTTGTT GTGACAGCGA CTGACTTTTG AATACGTCTT
TCTTTCCTTC TCTGTGGACA CAgcaaggat gggttttcct tttcagctta atcggcatca cgcccttggc tgagagattg
ggatatgcga ccgagtaagt gctactgatt actgaattca ctgtaaatct gtaattaccc agttagttgt acttactatt
gtgtcaaaat tctcctgaca ttgtggctac ttcctctctt gcaggcagct tgctctctac acgggtccga caagtatgtg
ctttcatttt gtacctgtcc tatcttttca ttcaaatctt ggcttcgtcg gatggtaaag attcaaactt ttctgaactg
cagttggggg gctgttgaat gctacctttg gcaatgcgac tgagatgatt atctcgttgt acgcattgaa aaacgggatg
atccgtgtcg tccagcaatc gctactaggc tctatactgt caaacatgct gttggttctc ggttgtgctt tcttcgctgg
gggtcttgtc catcccagca gggaccaggt cttcaacaag gtagctttat gtacaataca gtagttctcc ttattatatt
tcccttacaa ttctcatatg tagcctcagt tttgacatac atttatggat gcaggcgtca gccgttgtaa actcaggatt
gcttttgatg gctgtcttgg gtctaatgtt tccagcagta cttcacttta cacattctga agtgcagtat ggaaaatccg
aagtttccct ttcaaggttt agtagctgca tcatgcttgt ggcatatgca agctatctgt tttttcaact aaagagccag
cgaagtctgt acagtccaat tggtgaagta agtagctgaa gcgctaattt ctgcacactt tgaaaactga acagccatat
atgcgtaaag aaataacaat gttaattatg taaaaagggc ttgggatcac ctcaaactat ctattgtaat actcaatttc
tcctcagtat catgtaatac aagtaatcaa gctgcacatg atgcatgtaa tgagatggca accttttttt ctttatcaat
ttgttagctc tacactgtta ctccttgtgc ccttctatga gttttgacag agtaaaacat gacttttggc cacctttctg
acattccata agtgtcatgt taccagatta ttttcccaac agtttgggca cttccaatta catactttgt gaatccacct
agggcaagta aaacctacct gacaagacaa agaataaaat ttgagatatt tgtttcttgc atgtcgttat atatgcttat
actgtgcaca cttcaacatc ctgtagcagg aagaagaagt aactgaggat gaggaggaag aaaaggagat aacacagggt
gaagctatct gttggctttt tgtgttgact atttggattt cgattctctc tgggtacctg gtagacgcca tacaggtatt
gaagagttcg ttgaagatta catcatgcct gttatatgtt gctcccatca gacctggatt tcgctagtta cttaccttta
ttatttgctg cttctatgcc atattaagcg aggaaatgta ttttttaccc tttaacattg catcattcat atgttataac
agggggcctc tgaatcatta aacatgccag tggcctttat tagtgttatt ctgcttccaa tcgtgggaaa tgctgctgag
cacgcaagtg ccattatgtt tgccatgaaa gacaaacttg taaggaacca aaggatacta tttcaatatg gtttatatgt
taatcgtgtg ctatcttctt atttttaatc tcaccctatt ccaaaggata ttacacttgg agttgccata ggatcgtcaa
cacagatctc catgtttgtg gtaagaacat aaatgaatag catgcaacta atctgctgtg gttttgcaag ctctgtaccg
ttacaagacc atgttaatga caactagttg ttgtagtaat gttgaaactg ttccaaccaa cacacttttt tacatgattt
gcagatccca ttctgtgtgg taattggctg gataatgggc caacaaatgg acttgaattt tcaactgttc gagacagcaa
ctctttttat aacagtactg gtggtggcat ttatgttgca ggtgtgttTA GAGAACTTAT TAGCATCCTC TGTATTGTTC
ATACTTTATA CAATTACAAG AGATCTTACT TTTATGATCT AGTGCACATT CTAATTCTGA ATAAATGTTT CCAGGAAGGA
ACATCGAACT ATTTTAAAGG CCTTATGCTT ATCTTATGCT ATCTCATAGT TGCTGCGAGC TTCTTCGTAC ATGTTGATCC
CGATTCAAGT AAGTATTTTG TTTGGCATTC AACCTCGACA ACTATCCCAA AACTATTTCA CCAGTTCTAC TGGTTCTTAG
GTGTAATGGT AAATTAGTTA TCTATCTGCC TAAATTACTT CTATCCTCTG GGGCTCTGGG AATCTATCCA GCTGATTGAC
CAATTACCAT TAGTCTGATT TCCTTACATG AAGGACAGAT TTAGCTAAAT TACTATCAGC TCTGACAGAT GGTTATTGAT
ACATGACACA ACTTTTTTAT GTCCTGCACT TCTATCAATA ACACTTAACT CGATAAAATC ACTCAACAAA GTGGTTGGTC
CAACACGACT GATTGTTAGA AGAAAATTTA AAGTTGACCC GTCTCTATAA TGTACTGAGT CTCCGCTGTA TCTCATGACC
AAGTACCTTG TTTGACCTGA AGCAGGTAAC AACAAGTGAA AGATCCGCAA CAATTTGTGG AATGATAAGG GATGAGCATA
TTGGAATGTC AGCACTAGCA AACAGCAGTA TTTGCAACAT ATCATCTGTC CGAGTCCTGA TTTTTGACGG CCTATACCTG
TCAGCAGTAT CTCACACGGA GGCTTCAACT TCCGGCCTGG AGTTGCAAGG GCCCTGATGC GGCTTTTTTA AGATAGCGAC
GGCATCGCCC TTTGATTGAG AACCTGTAAC TTTATTATGG GATAGTGTAA TGTGCCAAGA TCACTAGTCT GTATTTGCTG
AAGAAACACT TGTCGCGATT TTTGATGATG TTGTTGTACT GATGCCAATG AACTGGCTAT AGCGTTGCAG TTCAAGGGAC
ACTGGATAAC TGGACTACAT AGTCCATACA CATTTCCAAA CGGTGCCAGT TGTGCAACAT GATTTGTCAC TGCACATAAT
TTATTTGTCT AGGATGGGTT GCTCGTTTTT GAATGCTTGC TTGCTTATAA GAGAACAGGT TTCTAG

Locus: Os03g0397400

Loading...

Locus: Os03g0397400

Loading...