Os03t0401300-01

Locus

Os03g0401300

Description

Sucrose synthase 2 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase 2).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RSUS1

CGSNL Gene Name

SUCROSE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

sus1, RSus1(t), SUS1, SS2, OsScS2, RSs2, RSus1, SuSy1, OsSUS1, RSS2, RSus2, OsRSUS1

Oryzabase Gene Name Synonym(s)

sucrose synthase1, Sucrose synthase 1, Sucrose synthase 2, Sucrose-UDP glucosyltransferase 1, Sucrose synthase-2, rice SuSy gene 2, sucrose-UDP glucosyltransferase isozyme 2

Transcript Evidence

AK100334 (DDBJ, Best hit)

Protein Evidence

P31924 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: sucrose metabolic process (GO:0005985)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: sucrose synthase activity (GO:0016157)

Functional domain (InterPro)

Sucrose synthase (IPR000368)

Glycosyl transferase, family 1 (IPR001296)

Sucrose synthase, plant/cyanobacteria (IPR012820)

Full-length cDNA

J023080P07 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0401300-01)

RiceXPro (AK100334)

Others

Oryzabase (2198)

KEGG (Os03t0401300-01 (EC:2.4.1.13))

Transcript

2907 bp

>Os03t0401300-01 Sucrose synthase 2 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase 2).
AGGCTTGAGGAGCCAAGAGGAAGAGGAGAGCAATGGGGGAAGCTGCCGGCGACCGCGTCC
TGAGCCGCCTCCACAGCGTCAGGGAGCGCATCGGCGACTCCCTCTCCGCCCACCCCAATG
AGCTCGTCGCCGTCTTCACCAGGCTGGTTAACCTCGGAAAGGGAATGCTTCAGGCCCACC
AGATCATTGCTGAGTACAACAACGCAATCTCTGAGGCTGATCGTGAGAAGCTGAAGGACG
GTGCTTTTGAGGATGTCCTGAGGAGTGCACAGGAGGGGATTGTTATCTCCCCATGGGTTG
CCCTTGCCATCCGCCCGAGGCCCGGTGTCTGGGAGTATGTGAGGGTCAATGTGAGCGAGC
TCGCTGTTGAGTTGCTGACAGTCCCCGAGTACTTGCAGTTCAAGGAACAGCTTGTGGAAG
AAGGCACCAACAACAACTTTGTGCTTGAGCTGGATTTCGAGCCATTCAATGCCTCCTTCC
CTCGTCCTTCTCTGTCGAAGTCCATTGGCAATGGTGTGCAGTTCCTCAACAGGCATCTGT
CATCGAAGCTCTTCCATGACAAGGAGAGCATGTACCCACTGCTCAACTTCCTTCGTGCAC
ACAACTACAAGGGCATGACCATGATGTTGAATGACAGAATCCGCAGTCTCAGTGCTCTCC
AAGGTGCTCTGAGGAAGGCTGAGGAGCATCTTTCTGGTCTTTCAGCAGACACCCCTTACT
CAGAATTCCACCACAGGTTCCAGGAACTTGGTCTGGAGAAGGGTTGGGGTGACTGTGCCA
AGCGTTCCCAGGAGACCATTCACCTCCTTTTGGACCTTCTTGAGGCCCCTGATCCGTCCA
CCCTCGAGAAGTTCCTTGGAACAATCCCAATGGTGTTCAATGTTGTCATTATGTCCCCAC
ACGGTTACTTCGCGCAAGCCAATGTCTTGGGTTACCCTGACACTGGAGGGCAGgttgtct
acattttggaccaagtccgtgctatggagaatgagatgcttctgaggatcaagcagcaag
gtctcaatattacaccacgcatccttattGTCACCAGGTTGCTCCCTGATGCAACTGGCA
CCACCTGCGGTCAGCGTCTTGAGAAGGTCCTTGGCACCGAGCACACCCACATCCTACGTG
TGCCTTTCAGAACTGAAAATGGAATTGTTCGCAAGTGGATCTCACGTTTTGAAGTCTGGC
CGTACCTGGAAACATTCACTGATGATGTCGCGCACGAAATTGCTGGAGAGCTCCAGGCCA
ATCCTGACTTGATCATCGGAAACTACAGTGACGGAAACCTTGTTGCATGCTTGCTTGCAC
ACAAGATGGGTGTTACCCATTGTACCATTGCCCATGCGCTTGAGAAAACCAAGTACCCCA
ACTCTGACCTCTACTGGAAGAAGTTTGAGGATCACTACCACTTCTCATGCCAGTTCACAA
CTGACTTGATTGCGATGAACCACGCTGACTTCATCATCACCAGTACCTTCCAAGAGATTG
CCGGAAACAAGGACACTGTTGGTCAGTATGAGTCTCACATGGCATTCACCATGCCTGGTC
TGTACCGTGTTGTCCACGGTATTGATGTTTTTGACCCGAAGTTTAACATTGTCTCGCCTG
GTGCGGACATGTCCATCTACTTCCCTTACTCTGAGTCTCGTAAGAGGCTCACCTCCCTCC
ACCCAGAGATTGAGGAGTTGCTCTACAGCGAAGTTGACAACAACGAGCACAAGTTTATGC
TGAAGGACAGGAACAAGCCAATCATCTTCTCCATGGCTCGTCTTGACCGTGTCAAGAACT
TGACTGGTCTGGTTGAGCTGTATGGTCGCAACCCTCGCCTGCAAGAGCTGGTTAACCTTG
TGGTTGTCTGTGGTGACCATGGCAACCCATCTAAGGACAAGGAGGAGCAGGCTGAGTTCA
AGAAGATGTTTGACCTTATTGAGCAATACAACTTGAATGGCCACATCCGCTGGATCTCCG
CGCAGATGAACCGTGTCCGCAACGGTGAGCTCTACCGTTACATCTGCGACACCAAGGGTG
CTTTTGTGCAGCCCGCTTTCTACGAGGCATTCGGTCTCACTGTTGTTGAGTCCATGACCT
GTGGTCTCCCGACATTCGCAACCGCCTATGGTGGTCCAGCTGAGATCATCGTGAACGGAG
TGTCTGGCTTCCACATTGACCCATACCAGGGTGACAAGGCCTCGGCGCTGCTCGTTGAGT
TCTTTGAGAAGTGCCAGGAAGACCCCAGCCACTGGACCAAGATCTCGCAGGGCGGTCTTC
AGCGTATCGAGGAGAAatacacctggaagctctactctgagaggctgatgACCCTCACCG
GCGTCTACGGATTCTGGAAGTACGTCTCGAACCTGGAGAGGCGTGAAACCCGCCGCTACC
TTGAGATGCTGTATGCCCTCAAGTACCGCACCATGGCTAGCACCGTCCCGTTGGCCGTCG
AGGGCGAGCCGTCGAACAAGTGAGCTGGCCAACATCTCAGGCTGAGACTCTGAAAGAGGA
GAGCATTGGAGTTTCTTTGCTTTGTTTCCATTCTCTGGTTTCAGAGATGAAAAGAGAAGA
GAGATATTTCAGGATGCTTTGCATTCCTAGGCACTGCTCTTTTTCCTTAAGAAAGTAAGG
TCGATTGAATTTGGGAGTTTTCTAGTTTGATTTAGTTGGGGGTGAGTTCAGTGGAATGTG
GTGTGTGGTTGGTGCTCTGTCTCCTCTTGTTATTGGGATGTTACCTATGAATAATAGAAA
CGGCCTTGGTGCCGTTTCTGCAATAATATATTGTAGCATCCTTGTTTCCAAGAAAAAATT
GTCACTGAAATGCTCACTTCTCCTTGGGGTTATCTTACTGTTTATTTATGTTTCACCAAT
CGAAATCCTTACTGTGCATCTTTGACT

CDS

2451 bp

>Os03t0401300-01 Sucrose synthase 2 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase 2).
ATGGGGGAAGCTGCCGGCGACCGCGTCCTGAGCCGCCTCCACAGCGTCAGGGAGCGCATC
GGCGACTCCCTCTCCGCCCACCCCAATGAGCTCGTCGCCGTCTTCACCAGGCTGGTTAAC
CTCGGAAAGGGAATGCTTCAGGCCCACCAGATCATTGCTGAGTACAACAACGCAATCTCT
GAGGCTGATCGTGAGAAGCTGAAGGACGGTGCTTTTGAGGATGTCCTGAGGAGTGCACAG
GAGGGGATTGTTATCTCCCCATGGGTTGCCCTTGCCATCCGCCCGAGGCCCGGTGTCTGG
GAGTATGTGAGGGTCAATGTGAGCGAGCTCGCTGTTGAGTTGCTGACAGTCCCCGAGTAC
TTGCAGTTCAAGGAACAGCTTGTGGAAGAAGGCACCAACAACAACTTTGTGCTTGAGCTG
GATTTCGAGCCATTCAATGCCTCCTTCCCTCGTCCTTCTCTGTCGAAGTCCATTGGCAAT
GGTGTGCAGTTCCTCAACAGGCATCTGTCATCGAAGCTCTTCCATGACAAGGAGAGCATG
TACCCACTGCTCAACTTCCTTCGTGCACACAACTACAAGGGCATGACCATGATGTTGAAT
GACAGAATCCGCAGTCTCAGTGCTCTCCAAGGTGCTCTGAGGAAGGCTGAGGAGCATCTT
TCTGGTCTTTCAGCAGACACCCCTTACTCAGAATTCCACCACAGGTTCCAGGAACTTGGT
CTGGAGAAGGGTTGGGGTGACTGTGCCAAGCGTTCCCAGGAGACCATTCACCTCCTTTTG
GACCTTCTTGAGGCCCCTGATCCGTCCACCCTCGAGAAGTTCCTTGGAACAATCCCAATG
GTGTTCAATGTTGTCATTATGTCCCCACACGGTTACTTCGCGCAAGCCAATGTCTTGGGT
TACCCTGACACTGGAGGGCAGgttgtctacattttggaccaagtccgtgctatggagaat
gagatgcttctgaggatcaagcagcaaggtctcaatattacaccacgcatccttattGTC
ACCAGGTTGCTCCCTGATGCAACTGGCACCACCTGCGGTCAGCGTCTTGAGAAGGTCCTT
GGCACCGAGCACACCCACATCCTACGTGTGCCTTTCAGAACTGAAAATGGAATTGTTCGC
AAGTGGATCTCACGTTTTGAAGTCTGGCCGTACCTGGAAACATTCACTGATGATGTCGCG
CACGAAATTGCTGGAGAGCTCCAGGCCAATCCTGACTTGATCATCGGAAACTACAGTGAC
GGAAACCTTGTTGCATGCTTGCTTGCACACAAGATGGGTGTTACCCATTGTACCATTGCC
CATGCGCTTGAGAAAACCAAGTACCCCAACTCTGACCTCTACTGGAAGAAGTTTGAGGAT
CACTACCACTTCTCATGCCAGTTCACAACTGACTTGATTGCGATGAACCACGCTGACTTC
ATCATCACCAGTACCTTCCAAGAGATTGCCGGAAACAAGGACACTGTTGGTCAGTATGAG
TCTCACATGGCATTCACCATGCCTGGTCTGTACCGTGTTGTCCACGGTATTGATGTTTTT
GACCCGAAGTTTAACATTGTCTCGCCTGGTGCGGACATGTCCATCTACTTCCCTTACTCT
GAGTCTCGTAAGAGGCTCACCTCCCTCCACCCAGAGATTGAGGAGTTGCTCTACAGCGAA
GTTGACAACAACGAGCACAAGTTTATGCTGAAGGACAGGAACAAGCCAATCATCTTCTCC
ATGGCTCGTCTTGACCGTGTCAAGAACTTGACTGGTCTGGTTGAGCTGTATGGTCGCAAC
CCTCGCCTGCAAGAGCTGGTTAACCTTGTGGTTGTCTGTGGTGACCATGGCAACCCATCT
AAGGACAAGGAGGAGCAGGCTGAGTTCAAGAAGATGTTTGACCTTATTGAGCAATACAAC
TTGAATGGCCACATCCGCTGGATCTCCGCGCAGATGAACCGTGTCCGCAACGGTGAGCTC
TACCGTTACATCTGCGACACCAAGGGTGCTTTTGTGCAGCCCGCTTTCTACGAGGCATTC
GGTCTCACTGTTGTTGAGTCCATGACCTGTGGTCTCCCGACATTCGCAACCGCCTATGGT
GGTCCAGCTGAGATCATCGTGAACGGAGTGTCTGGCTTCCACATTGACCCATACCAGGGT
GACAAGGCCTCGGCGCTGCTCGTTGAGTTCTTTGAGAAGTGCCAGGAAGACCCCAGCCAC
TGGACCAAGATCTCGCAGGGCGGTCTTCAGCGTATCGAGGAGAAatacacctggaagctc
tactctgagaggctgatgACCCTCACCGGCGTCTACGGATTCTGGAAGTACGTCTCGAAC
CTGGAGAGGCGTGAAACCCGCCGCTACCTTGAGATGCTGTATGCCCTCAAGTACCGCACC
ATGGCTAGCACCGTCCCGTTGGCCGTCGAGGGCGAGCCGTCGAACAAGTGA

Protein

817 aa

>Os03t0401300-01 Sucrose synthase 2 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase 2).
MGEAAGDRVLSRLHSVRERIGDSLSAHPNELVAVFTRLVNLGKGMLQAHQIIAEYNNAIS
EADREKLKDGAFEDVLRSAQEGIVISPWVALAIRPRPGVWEYVRVNVSELAVELLTVPEY
LQFKEQLVEEGTNNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM
YPLLNFLRAHNYKGMTMMLNDRIRSLSALQGALRKAEEHLSGLSADTPYSEFHHRFQELG
LEKGWGDCAKRSQETIHLLLDLLEAPDPSTLEKFLGTIPMVFNVVIMSPHGYFAQANVLG
YPDTGGQVVYILDQVRAMENEMLLRIKQQGLNITPRILIVTRLLPDATGTTCGQRLEKVL
GTEHTHILRVPFRTENGIVRKWISRFEVWPYLETFTDDVAHEIAGELQANPDLIIGNYSD
GNLVACLLAHKMGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADF
IITSTFQEIAGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYS
ESRKRLTSLHPEIEELLYSEVDNNEHKFMLKDRNKPIIFSMARLDRVKNLTGLVELYGRN
PRLQELVNLVVVCGDHGNPSKDKEEQAEFKKMFDLIEQYNLNGHIRWISAQMNRVRNGEL
YRYICDTKGAFVQPAFYEAFGLTVVESMTCGLPTFATAYGGPAEIIVNGVSGFHIDPYQG
DKASALLVEFFEKCQEDPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSN
LERRETRRYLEMLYALKYRTMASTVPLAVEGEPSNK*

5'UTR

chr03:16306058..16306089 (- strand) : 32 bp

CDS

chr03:16305948..16306057 (- strand) : 110 bp

chr03:16305090..16305219 (- strand) : 130 bp

chr03:16304843..16304994 (- strand) : 152 bp

chr03:16304530..16304722 (- strand) : 193 bp

chr03:16304286..16304404 (- strand) : 119 bp

chr03:16303950..16304166 (- strand) : 217 bp

chr03:16303770..16303865 (- strand) : 96 bp

chr03:16303515..16303688 (- strand) : 174 bp

chr03:16303311..16303427 (- strand) : 117 bp

chr03:16303061..16303227 (- strand) : 167 bp

chr03:16302732..16302956 (- strand) : 225 bp

chr03:16302327..16302645 (- strand) : 319 bp

chr03:16301984..16302228 (- strand) : 245 bp

chr03:16301703..16301889 (- strand) : 187 bp

3'UTR

chr03:16301279..16301702 (- strand) : 424 bp

FASTA

>Os03t0401300-01 class=Sequence position=chr03:16301279..16306089 (- strand)
AGGCTTGAGG AGCCAAGAGG AAGAGGAGAG CAATGGGGGA AGCTGCCGGC GACCGCGTCC TGAGCCGCCT CCACAGCGTC
AGGGAGCGCA TCGGCGACTC CCTCTCCGCC CACCCCAATG AGCTCGTCGC CGTCTTCACC AGGTTCGTGC TGATTTAGTG
ATTTCCCAGC ATTAGATTTT GTTGGTTTCT AGTCTACTGC CTTCAGATGT TACTGTATTT TCTTTTAGAA GGAGATGTTC
ATATAGGATC TTTGTTGTTG AGATTGTTAG ATCTGGCCAG GAATGGCTCA TATTTACTGA ATTGGATGCA ATCATTTTGT
AGTCACTTTT TTTTTAAGTT TCTGATTAGA ATGAATATTT AAGTGCGGCC TTCTGCAGCC AAGATTTTGT ACAAACCTAG
TACTACTGAA TAATGATGAA ATATACAAAT GTAGTTTTGG ATTACTGTGG ACTGGTAGTG CTAGATCTGA CTGCATGTGC
ATGTTATTTA TATTATATAT ACGGTTTACA AACTGAATAC AAGTAATGAA TTCTGCACTG GTACAGATGC TTGTTGTGGT
AGCAAAGTTT CACAAAAAAA ATAAAAAACC TACATCTTAC TAGATCTATT GGCGCGAGCG CGTAGATCTG ATTATCGCGC
ATATTTCATT AAGTCCAATT AAATGGTCAA AACTAATCAT TTCATATCTA CAATGAAATT TTTAATTCAT CTCAATGCAA
ACAGATCATA TATGGTCTTT TTAAGTGGCT AATAGCAAAT TTTCTTATTA TGCGCAAATG CTCAAGTGCT AAAATTATCT
TATTGAGATA TTTATAGGCT GAGTTGATAG ATCTGGCCTG ATATTTTTGT TGACACTGTT ATTTGCGCAG GCTGGTTAAC
CTCGGAAAGG GAATGCTTCA GGCCCACCAG ATCATTGCTG AGTACAACAA CGCAATCTCT GAGGCTGATC GTGAGAAGCT
GAAGGACGGT GCTTTTGAGG ATGTCCTGAG GAGTGCACAG GTTTGAATCA GATTCAGATT TCATTGCATC ACAGAGATCC
ATCTTTACTC TACCGCTTGC TCTAACTTAA CTTGTAATTG TTTTTTATCA TGCAGGAGGG GATTGTTATC TCCCCATGGG
TTGCCCTTGC CATCCGCCCG AGGCCCGGTG TCTGGGAGTA TGTGAGGGTC AATGTGAGCG AGCTCGCTGT TGAGTTGCTG
ACAGTCCCCG AGTACTTGCA GTTCAAGGAA CAGCTTGTGG AAGAAGGGTA TGAAATCTGC ATAATTGGGA TACTAAAAAC
ATATATTCTT AAAATTTAAA ACTTAATTTT ATTATTTTTC TTTTATCGAT ATATATGTCA TTGTAATATC TCTGATGTAT
ATTTCAGCAC CAACAACAAC TTTGTGCTTG AGCTGGATTT CGAGCCATTC AATGCCTCCT TCCCTCGTCC TTCTCTGTCG
AAGTCCATTG GCAATGGTGT GCAGTTCCTC AACAGGCATC TGTCATCGAA GCTCTTCCAT GACAAGGAGA GCATGTACCC
ACTGCTCAAC TTCCTTCGTG CACACAACTA CAAGGGCATG GTAAGGCAGC TTCATACTAT TTCCTCATCT CACATTTTTG
TACTATGGCA TATTAACATG AATTGAATTG ATTTTGAGAT GGAAGTATAA ATTCTGAATG GATGGAATAT ATATTTTTTC
TGCAGACCAT GATGTTGAAT GACAGAATCC GCAGTCTCAG TGCTCTCCAA GGTGCTCTGA GGAAGGCTGA GGAGCATCTT
TCTGGTCTTT CAGCAGACAC CCCTTACTCA GAATTCCACC ACAGGTACTG ATAATTATTT TTTACATATT ATGAACTCTA
GAATGTATTT TGATATGAAA CCACCGAAGA TATTTTGCCA GTATTGTTGT GACTAAAAAT GACCATTTGA TTGGAAAATA
CAGGTTCCAG GAACTTGGTC TGGAGAAGGG TTGGGGTGAC TGTGCCAAGC GTTCCCAGGA GACCATTCAC CTCCTTTTGG
ACCTTCTTGA GGCCCCTGAT CCGTCCACCC TCGAGAAGTT CCTTGGAACA ATCCCAATGG TGTTCAATGT TGTCATTATG
TCCCCACACG GTTACTTCGC GCAAGCCAAT GTCTTGGGTT ACCCTGACAC TGGAGGGCAG GTAGAATTCT TAATTTTGAC
ATTTGTTCAT ACTTAAAAAA ATTAAACCTG TTCTCATTAT TCTTTGTGCT ATGATTACCG AAaggttgtc tacattttgg
accaagtccg tgctatggag aatgagatgc ttctgaggat caagcagcaa ggtctcaata ttacaccacg catccttatt
gtaagtGGGA TACCTGATAT GGTGCAATAC AACTTGTCAG CTATAGCAAT ATGATATTTA ACCTTCTTTG GTCTTGAACA
GGTCACCAGG TTGCTCCCTG ATGCAACTGG CACCACCTGC GGTCAGCGTC TTGAGAAGGT CCTTGGCACC GAGCACACCC
ACATCCTACG TGTGCCTTTC AGAACTGAAA ATGGAATTGT TCGCAAGTGG ATCTCACGTT TTGAAGTCTG GCCGTACCTG
GAAACATTCA CTGATGTAGA TACCTAACCT CGCTGTCACA CCTTCTTGGT TATTCATTTA TTAAAGATAA ACTTCATATT
GACTCTTTCC CATGGATGTC AGGATGTCGC GCACGAAATT GCTGGAGAGC TCCAGGCCAA TCCTGACTTG ATCATCGGAA
ACTACAGTGA CGGAAACCTT GTTGCATGCT TGCTTGCACA CAAGATGGGT GTTACCCATG TACGCATTTT GACTACTCTG
ATCAGAAGTG TTTTAACTAC ATATTTGCTC ATTCTCATGT TGCCTTGTTC CATGATATGC AGTGTACCAT TGCCCATGCG
CTTGAGAAAA CCAAGTACCC CAACTCTGAC CTCTACTGGA AGAAGTTTGA GGATCACTAC CACTTCTCAT GCCAGTTCAC
AACTGACTTG ATTGCGATGA ACCACGCTGA CTTCATCATC ACCAGTACCT TCCAAGAGAT TGCCGGAAAG TAATATTTCT
ATACAACTAA AGTTTTCTGG GTCACATCCG TCAGTTATGT CGTAAAAATG CAATTACCTT TCCATGATCT AATGGCATTT
TCTGGTTTTT CAGCAAGGAC ACTGTTGGTC AGTATGAGTC TCACATGGCA TTCACCATGC CTGGTCTGTA CCGTGTTGTC
CACGGTATTG ATGTTTTTGA CCCGAAGTTT AACATTGTCT CGCCTGGTGC GGACATGTCC ATCTACTTCC CTTACTCTGA
GTCTCGTAAG AGGCTCACCT CCCTCCACCC AGAGATTGAG GAGTTGCTCT ACAGCGAAGT TGACAACAAC GAGCACAAGT
AAGAAGCGGT TTTTACATAG CTCGATCTAC ATTCATCTGA TGCATGTCGC CCTCATTATC TGACTAGAAT ACTCTCTGCA
ACAGGTTTAT GCTGAAGGAC AGGAACAAGC CAATCATCTT CTCCATGGCT CGTCTTGACC GTGTCAAGAA CTTGACTGGT
CTGGTTGAGC TGTATGGTCG CAACCCTCGC CTGCAAGAGC TGGTTAACCT TGTGGTTGTC TGTGGTGACC ATGGCAACCC
ATCTAAGGAC AAGGAGGAGC AGGCTGAGTT CAAGAAGATG TTTGACCTTA TTGAGCAATA CAACTTGAAT GGCCACATCC
GCTGGATCTC CGCGCAGATG AACCGTGTCC GCAACGGTGA GCTCTACCGT TACATCTGCG ACACCAAGGG TGCTTTTGTG
CAGGTAACTT AATGATGTTC TCTCATTGCA AAAATATCAT GGTTGAATAC TTGAATTGTA AATCTAACTG TTCTCAAATT
TATCTTGTCT TGCGTTTCCA GCCCGCTTTC TACGAGGCAT TCGGTCTCAC TGTTGTTGAG TCCATGACCT GTGGTCTCCC
GACATTCGCA ACCGCCTATG GTGGTCCAGC TGAGATCATC GTGAACGGAG TGTCTGGCTT CCACATTGAC CCATACCAGG
GTGACAAGGC CTCGGCGCTG CTCGTTGAGT TCTTTGAGAA GTGCCAGGAA GACCCCAGCC ACTGGACCAA GATCTCGCAG
GGCGGTCTTC AGCGTATCGA GGAGAAGTAT GCAAAACACA TCCCAGTAAT CTGTGTTTCT GAATACGCAT TTCGTCTTTC
TTGCAGTGCT AACATTATGT TTCTCCAACC TTTGTttcag atacacctgg aagctctact ctgagaggct gatgACCCTC
ACCGGCGTCT ACGGATTCTG GAAGTACGTC TCGAACCTGG AGAGGCGTGA AACCCGCCGC TACCTTGAGA TGCTGTATGC
CCTCAAGTAC CGCACCATGG CTAGCACCGT CCCGTTGGCC GTCGAGGGCG AGCCGTCGAA CAAGTGAGCT GGCCAACATC
TCAGGCTGAG ACTCTGAAAG AGGAGAGCAT TGGAGTTTCT TTGCTTTGTT TCCATTCTCT GGTTTCAGAG ATGAAAAGAG
AAGAGAGATA TTTCAGGATG CTTTGCATTC CTAGGCACTG CTCTTTTTCC TTAAGAAAGT AAGGTCGATT GAATTTGGGA
GTTTTCTAGT TTGATTTAGT TGGGGGTGAG TTCAGTGGAA TGTGGTGTGT GGTTGGTGCT CTGTCTCCTC TTGTTATTGG
GATGTTACCT ATGAATAATA GAAACGGCCT TGGTGCCGTT TCTGCAATAA TATATTGTAG CATCCTTGTT TCCAAGAAAA
AATTGTCACT GAAATGCTCA CTTCTCCTTG GGGTTATCTT ACTGTTTATT TATGTTTCAC CAATCGAAAT CCTTACTGTG
CATCTTTGAC T