Os03t0401300-02

Locus

Os03g0401300

Description

Similar to Sucrose synthase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RSUS1

CGSNL Gene Name

SUCROSE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

sus1, RSus1(t), SUS1, SS2, OsScS2, RSs2, RSus1, SuSy1, OsSUS1, RSS2, RSus2, OsRSUS1

Oryzabase Gene Name Synonym(s)

sucrose synthase1, Sucrose synthase 1, Sucrose synthase 2, Sucrose-UDP glucosyltransferase 1, Sucrose synthase-2, rice SuSy gene 2, sucrose-UDP glucosyltransferase isozyme 2

Transcript Evidence

AK061713 (DDBJ, Best hit)

Protein Evidence

P31924 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: sucrose metabolic process (GO:0005985)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: sucrose synthase activity (GO:0016157)

Functional domain (InterPro)

Sucrose synthase (IPR000368)

Glycosyl transferase, family 1 (IPR001296)

Sucrose synthase, plant/cyanobacteria (IPR012820)

Full-length cDNA

001-037-G10 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0401300-02)

RiceXPro (AK061713)

Others

Oryzabase (2198)

KEGG (Os03t0401300-02 (EC:2.4.1.13))

Transcript

1279 bp

>Os03t0401300-02 Similar to Sucrose synthase 1.
CTCACATGGCATTCACCATGCCTGGTCTGTACCGTGTTGTCCACGGTATTGATGTTTTTG
ACCCGAAGTTTAACATTGTCTCGCCTGGTGCGGACATGTCCATCTACTTCCCTTACTCTG
AGTCTCGTAAGAGGCTCACCTCCCTCCACCCAGAGATTGAGGAGTTGCTCTACAGCGAAG
TTGACAACAACGAGCACAAGTTTATGCTGAAGGACAGGAACAAGCCAATCATCTTCTCCA
TGGCTCGTCTTGACCGTGTCAAGAACTTGACTGGTCTGGTTGAGCTGTATGGTCGCAACC
CTCGCCTGCAAGAGCTGGTTAACCTTGTGGTTGTCTGTGGTGACCATGGCAACCCATCTA
AGGACAAGGAGGAGCAGGCTGAGTTCAAGAAGATGTTTGACCTTATTGAGCAATACAACT
TGAATGGCCACATCCGCTGGATCTCCGCGCAGATGAACCGTGTCCGCAACGGTGAGCTCT
ACCGTTACATCTGCGACACCAAGGGTGCTTTTGTGCAGCCCGCTTTCTACGAGGCATTCG
GTCTCACTGTTGTTGAGTCCATGACCTGTGGTCTCCCGACATTCGCAACCGCCTATGGTG
GTCCAGCTGAGATCATCGTGAACGGAGTGTCTGGCTTCCACATTGACCCATACCAGGGTG
ACAAGGCCTCGGCGCTGCTCGTTGAGTTCTTTGAGAAGTGCCAGGAAGACCCCAGCCACT
GGACCAAGATCTCGCAGGGCGGTCTTCAGCGTATCGAGGAGAAatacacctggaagctct
actctgagaggctgatgACCCTCACCGGCGTCTACGGATTCTGGAAGTACGTCTCGAACC
TGGAGAGGCGTGAAACCCGCCGCTACCTTGAGATGCTGTATGCCCTCAAGTACCGCACCA
TGGCTAGCACCGTCCCGTTGGCCGTCGAGGGCGAGCCGTCGAACAAGTGAGCTGGCCAAC
ATCTCAGGCTGAGACTCTGAAAGAGGAGAGCATTGGAGTTTCTTTGCTTTGTTTCCATTC
TCTGGTTTCAGAGATGAAAAGAGAAGAGAGATATTTCAGGATGCTTTGCATTCCTAGGCA
CTGCTCTTTTTCCTTAAGAAAGTAAGGTCGATTGAATTTGGGAGTTTTCTAGTTTGATTT
AGTTGGGGGTGAGTTCAGTGGAATGTGGTGTGTGGTTGGTGCTCTGTCTCCTCTTGTTAT
TGGGATGTTACCTATGAATAATAGAAACGGCCTTGGTGCCGTTTCTGCAATAATATATTG
TAGCATCCTTGTTTCCAAG

CDS

948 bp

>Os03t0401300-02 Similar to Sucrose synthase 1.
CACATGGCATTCACCATGCCTGGTCTGTACCGTGTTGTCCACGGTATTGATGTTTTTGAC
CCGAAGTTTAACATTGTCTCGCCTGGTGCGGACATGTCCATCTACTTCCCTTACTCTGAG
TCTCGTAAGAGGCTCACCTCCCTCCACCCAGAGATTGAGGAGTTGCTCTACAGCGAAGTT
GACAACAACGAGCACAAGTTTATGCTGAAGGACAGGAACAAGCCAATCATCTTCTCCATG
GCTCGTCTTGACCGTGTCAAGAACTTGACTGGTCTGGTTGAGCTGTATGGTCGCAACCCT
CGCCTGCAAGAGCTGGTTAACCTTGTGGTTGTCTGTGGTGACCATGGCAACCCATCTAAG
GACAAGGAGGAGCAGGCTGAGTTCAAGAAGATGTTTGACCTTATTGAGCAATACAACTTG
AATGGCCACATCCGCTGGATCTCCGCGCAGATGAACCGTGTCCGCAACGGTGAGCTCTAC
CGTTACATCTGCGACACCAAGGGTGCTTTTGTGCAGCCCGCTTTCTACGAGGCATTCGGT
CTCACTGTTGTTGAGTCCATGACCTGTGGTCTCCCGACATTCGCAACCGCCTATGGTGGT
CCAGCTGAGATCATCGTGAACGGAGTGTCTGGCTTCCACATTGACCCATACCAGGGTGAC
AAGGCCTCGGCGCTGCTCGTTGAGTTCTTTGAGAAGTGCCAGGAAGACCCCAGCCACTGG
ACCAAGATCTCGCAGGGCGGTCTTCAGCGTATCGAGGAGAAatacacctggaagctctac
tctgagaggctgatgACCCTCACCGGCGTCTACGGATTCTGGAAGTACGTCTCGAACCTG
GAGAGGCGTGAAACCCGCCGCTACCTTGAGATGCTGTATGCCCTCAAGTACCGCACCATG
GCTAGCACCGTCCCGTTGGCCGTCGAGGGCGAGCCGTCGAACAAGTGA

Protein

316 aa

>Os03t0401300-02 Similar to Sucrose synthase 1.
HMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYSESRKRLTSLHPEIEELLYSEV
DNNEHKFMLKDRNKPIIFSMARLDRVKNLTGLVELYGRNPRLQELVNLVVVCGDHGNPSK
DKEEQAEFKKMFDLIEQYNLNGHIRWISAQMNRVRNGELYRYICDTKGAFVQPAFYEAFG
LTVVESMTCGLPTFATAYGGPAEIIVNGVSGFHIDPYQGDKASALLVEFFEKCQEDPSHW
TKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYALKYRTM
ASTVPLAVEGEPSNK*

5'UTR

chr03:16302929..16302930 (- strand) : 2 bp

CDS

chr03:16302732..16302928 (- strand) : 197 bp

chr03:16302327..16302645 (- strand) : 319 bp

chr03:16301984..16302228 (- strand) : 245 bp

chr03:16301703..16301889 (- strand) : 187 bp

3'UTR

chr03:16301374..16301702 (- strand) : 329 bp

FASTA

>Os03t0401300-02 class=Sequence position=chr03:16301374..16302930 (- strand)
CTCACATGGC ATTCACCATG CCTGGTCTGT ACCGTGTTGT CCACGGTATT GATGTTTTTG ACCCGAAGTT TAACATTGTC
TCGCCTGGTG CGGACATGTC CATCTACTTC CCTTACTCTG AGTCTCGTAA GAGGCTCACC TCCCTCCACC CAGAGATTGA
GGAGTTGCTC TACAGCGAAG TTGACAACAA CGAGCACAAG TAAGAAGCGG TTTTTACATA GCTCGATCTA CATTCATCTG
ATGCATGTCG CCCTCATTAT CTGACTAGAA TACTCTCTGC AACAGGTTTA TGCTGAAGGA CAGGAACAAG CCAATCATCT
TCTCCATGGC TCGTCTTGAC CGTGTCAAGA ACTTGACTGG TCTGGTTGAG CTGTATGGTC GCAACCCTCG CCTGCAAGAG
CTGGTTAACC TTGTGGTTGT CTGTGGTGAC CATGGCAACC CATCTAAGGA CAAGGAGGAG CAGGCTGAGT TCAAGAAGAT
GTTTGACCTT ATTGAGCAAT ACAACTTGAA TGGCCACATC CGCTGGATCT CCGCGCAGAT GAACCGTGTC CGCAACGGTG
AGCTCTACCG TTACATCTGC GACACCAAGG GTGCTTTTGT GCAGGTAACT TAATGATGTT CTCTCATTGC AAAAATATCA
TGGTTGAATA CTTGAATTGT AAATCTAACT GTTCTCAAAT TTATCTTGTC TTGCGTTTCC AGCCCGCTTT CTACGAGGCA
TTCGGTCTCA CTGTTGTTGA GTCCATGACC TGTGGTCTCC CGACATTCGC AACCGCCTAT GGTGGTCCAG CTGAGATCAT
CGTGAACGGA GTGTCTGGCT TCCACATTGA CCCATACCAG GGTGACAAGG CCTCGGCGCT GCTCGTTGAG TTCTTTGAGA
AGTGCCAGGA AGACCCCAGC CACTGGACCA AGATCTCGCA GGGCGGTCTT CAGCGTATCG AGGAGAAGTA TGCAAAACAC
ATCCCAGTAA TCTGTGTTTC TGAATACGCA TTTCGTCTTT CTTGCAGTGC TAACATTATG TTTCTCCAAC CTTTGTttca
gatacacctg gaagctctac tctgagaggc tgatgACCCT CACCGGCGTC TACGGATTCT GGAAGTACGT CTCGAACCTG
GAGAGGCGTG AAACCCGCCG CTACCTTGAG ATGCTGTATG CCCTCAAGTA CCGCACCATG GCTAGCACCG TCCCGTTGGC
CGTCGAGGGC GAGCCGTCGA ACAAGTGAGC TGGCCAACAT CTCAGGCTGA GACTCTGAAA GAGGAGAGCA TTGGAGTTTC
TTTGCTTTGT TTCCATTCTC TGGTTTCAGA GATGAAAAGA GAAGAGAGAT ATTTCAGGAT GCTTTGCATT CCTAGGCACT
GCTCTTTTTC CTTAAGAAAG TAAGGTCGAT TGAATTTGGG AGTTTTCTAG TTTGATTTAG TTGGGGGTGA GTTCAGTGGA
ATGTGGTGTG TGGTTGGTGC TCTGTCTCCT CTTGTTATTG GGATGTTACC TATGAATAAT AGAAACGGCC TTGGTGCCGT
TTCTGCAATA ATATATTGTA GCATCCTTGT TTCCAAG