Os03t0401300-03

Locus

Os03g0401300

Description

Similar to Sucrose synthase metabolism (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RSUS1

CGSNL Gene Name

SUCROSE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

sus1, RSus1(t), SUS1, SS2, OsScS2, RSs2, RSus1, SuSy1, OsSUS1, RSS2, RSus2, OsRSUS1

Oryzabase Gene Name Synonym(s)

sucrose synthase1, Sucrose synthase 1, Sucrose synthase 2, Sucrose-UDP glucosyltransferase 1, Sucrose synthase-2, rice SuSy gene 2, sucrose-UDP glucosyltransferase isozyme 2

Transcript Evidence

AK119198 (DDBJ, Best hit)

Protein Evidence

A6MZV1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: sucrose synthase activity (GO:0016157)

Functional domain (InterPro)

Glycosyl transferase, family 1 (IPR001296)

Sucrose synthase, plant/cyanobacteria (IPR012820)

Full-length cDNA

001-041-D01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0401300-03)

RiceXPro (AK119198)

Others

Oryzabase (2198)

KEGG (Os03t0401300-03 (EC:2.4.1.13))

Transcript

726 bp

>Os03t0401300-03 Similar to Sucrose synthase metabolism (Fragment).
TGTTGAGTCCATGACCTGTGGTCTCCCGACATTCGCAACCGCCTATGGTGGTCCAGCTGA
GATCATCGTGAACGGAGTGTCTGGCTTCCACATTGACCCATACCAGGGTGACAAGGCCTC
GGCGCTGCTCGTTGAGTTCTTTGAGAAGTGCCAGGAAGACCCCAGCCACTGGACCAAGAT
CTCGCAGGGCGGTCTTCAGCGTATCGAGGAGAAatacacctggaagctctactctgagag
gctgatgACCCTCACCGGCGTCTACGGATTCTGGAAGTACGTCTCGAACCTGGAGAGGCG
TGAAACCCGCCGCTACCTTGAGATGCTGTATGCCCTCAAGTACCGCACCATGGCTAGCAC
CGTCCCGTTGGCCGTCGAGGGCGAGCCGTCGAACAAGTGAGCTGGCCAACATCTCAGGCT
GAGACTCTGAAAGAGGAGAGCATTGGAGTTTCTTTGCTTTGTTTCCATTCTCTGGTTTCA
GAGATGAAAAGAGAAGAGAGATATTTCAGGATGCTTTGCATTCCTAGGCACTGCTCTTTT
TCCTTAAGAAAGTAAGGTCGATTGAATTTGGGAGTTTTCTAGTTTGATTTAGTTGGGGGT
GAGTTCAGTGGAATGTGGTGTGTGGTTGGTGCTCTGTCTCCTCTTGTTATTGGGATGTTA
CCTATGAATAATAGAAACGGCCTTGGTGCCGTTTCTGCAATAATATATTGTAGCATCCTT
GTTTCC

CDS

399 bp

>Os03t0401300-03 Similar to Sucrose synthase metabolism (Fragment).
GTTGAGTCCATGACCTGTGGTCTCCCGACATTCGCAACCGCCTATGGTGGTCCAGCTGAG
ATCATCGTGAACGGAGTGTCTGGCTTCCACATTGACCCATACCAGGGTGACAAGGCCTCG
GCGCTGCTCGTTGAGTTCTTTGAGAAGTGCCAGGAAGACCCCAGCCACTGGACCAAGATC
TCGCAGGGCGGTCTTCAGCGTATCGAGGAGAAatacacctggaagctctactctgagagg
ctgatgACCCTCACCGGCGTCTACGGATTCTGGAAGTACGTCTCGAACCTGGAGAGGCGT
GAAACCCGCCGCTACCTTGAGATGCTGTATGCCCTCAAGTACCGCACCATGGCTAGCACC
GTCCCGTTGGCCGTCGAGGGCGAGCCGTCGAACAAGTGA

Protein

133 aa

>Os03t0401300-03 Similar to Sucrose synthase metabolism (Fragment).
VESMTCGLPTFATAYGGPAEIIVNGVSGFHIDPYQGDKASALLVEFFEKCQEDPSHWTKI
SQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYALKYRTMAST
VPLAVEGEPSNK*

5'UTR

chr03:16302196..16302196 (- strand) : 1 bp

CDS

chr03:16301984..16302195 (- strand) : 212 bp

chr03:16301703..16301889 (- strand) : 187 bp

3'UTR

chr03:16301377..16301702 (- strand) : 326 bp

FASTA

>Os03t0401300-03 class=Sequence position=chr03:16301377..16302196 (- strand)
TGTTGAGTCC ATGACCTGTG GTCTCCCGAC ATTCGCAACC GCCTATGGTG GTCCAGCTGA GATCATCGTG AACGGAGTGT
CTGGCTTCCA CATTGACCCA TACCAGGGTG ACAAGGCCTC GGCGCTGCTC GTTGAGTTCT TTGAGAAGTG CCAGGAAGAC
CCCAGCCACT GGACCAAGAT CTCGCAGGGC GGTCTTCAGC GTATCGAGGA GAAGTATGCA AAACACATCC CAGTAATCTG
TGTTTCTGAA TACGCATTTC GTCTTTCTTG CAGTGCTAAC ATTATGTTTC TCCAACCTTT GTttcagata cacctggaag
ctctactctg agaggctgat gACCCTCACC GGCGTCTACG GATTCTGGAA GTACGTCTCG AACCTGGAGA GGCGTGAAAC
CCGCCGCTAC CTTGAGATGC TGTATGCCCT CAAGTACCGC ACCATGGCTA GCACCGTCCC GTTGGCCGTC GAGGGCGAGC
CGTCGAACAA GTGAGCTGGC CAACATCTCA GGCTGAGACT CTGAAAGAGG AGAGCATTGG AGTTTCTTTG CTTTGTTTCC
ATTCTCTGGT TTCAGAGATG AAAAGAGAAG AGAGATATTT CAGGATGCTT TGCATTCCTA GGCACTGCTC TTTTTCCTTA
AGAAAGTAAG GTCGATTGAA TTTGGGAGTT TTCTAGTTTG ATTTAGTTGG GGGTGAGTTC AGTGGAATGT GGTGTGTGGT
TGGTGCTCTG TCTCCTCTTG TTATTGGGAT GTTACCTATG AATAATAGAA ACGGCCTTGG TGCCGTTTCT GCAATAATAT
ATTGTAGCAT CCTTGTTTCC