Os03t0407400-01

Locus

Os03g0407400

Description

Protein with plant-specific organ size regulation (OSR) domain, transmembrane region, TNFR/NGFR family cysteine-rich domain and VWFC module, Regulator of grain size and organ size

RAP-DB Gene Symbol Synonym(s)

GS3

RAP-DB Gene Name Synonym(s)

grain size 3

CGSNL Gene Symbol

LK3

CGSNL Gene Name

LONG KERNEL 3

Oryzabase Gene Symbol Synonym(s)

lk3(t), lk3(t)*, SG3, GS3, SG3-GS3, OsGW3, OsGS3, RGG3/GS3/Mi/OsGGC1, RGG3, Mi, OsGGC1, GGC1

Oryzabase Gene Name Synonym(s)

long kernel 3, long kernel-3, grain size, grain length and weight protein, GRAIN SIZE 3, G gamma subunit GS3, Heterotrimeric G Protein gamma3 Subunit

Transcript Evidence

AB488612

Protein Evidence

C6L686

Literature

PMID: 20974950

PMID: 19506305

PMID: 16453132

Note

Manual Curation

October 5, 2017

Gene Ontology (GO)

Biological Process: G-protein coupled receptor signaling pathway (GO:0007186)

Molecular Function: signal transducer activity (GO:0004871)

Cellular Component: heterotrimeric G-protein complex (GO:0005834)

Functional domain (InterPro)

G-protein gamma-like domain (IPR015898)

Expression Databases

TENOR (Os03t0407400-00)

Others

Oryzabase (2135)

KEGG (Os03t0407400-00)

Transcript

945 bp

>Os03t0407400-01 Protein with plant-specific organ size regulation (OSR) domain, transmembrane region, TNFR/NGFR family cysteine-rich domain and VWFC module, Regulator of grain size and organ size
GATCATCTCCATTATCGGAACTTCGGAGTGACATGGCAATGGCGGcggcgccccggccca
agtcgccgccggcgccgcccgacccatgcggccgccaccgcctccagctcgccgtcgacg
cgctccaCCGCGAGATCGGATTCCTCGAGGGTGAAATAAATTCAATCGAAGGGATCCACG
CTGCCTCCAGATGCTGCAGAGAGGTTGACGAATTCATCGGAAGAACTCCTGATCCATTCA
TAACGATTTCATCGGAGAAGCGAAGTCATGATCATTCTCACCACTTCTTGAAGAAGTTTC
GCTGTTTGTGCAGAGCAAGTGCGTGCTGCCTCAGCTACCTCTCCTGGATctgctgctgca
gcagcgccgccggcggctgctcatcctcctcctcctcctccttcaacctcaagaggccga
gctgctgctgcaactgcaactgcaactgctgctcctcctcctcctcctcATGTGGGGCGG
CGTTAACGAAGAGTCCGTGTCGCTGCCGCCGCCGCAGCTGCTGCTGCCGTCGCTGCTGCT
GCGGCGGCGTCGGCGTCCGCGCGTGCGCGAGCTGCAGCTGCTCCCCGCCGTGCGCGTGCT
GCGCGCCGCCGTGCGCGGGATGCTCGTGCCGCTGCACCTGCCCGTGCCCGTGCCCCGGCG
GCTGCTCCTGCGCGTGCCCGGCGTGCAGGTGCTGCTGCGGCGTCCCTCGTTGCTGCCCCC
CCTGCTTGTGATCGATCGATCGATTGAGCGAAGCTGCACTGATTGGTTAATTAATTAGTT
CTCGATGATGATCGATCGAGCTGCGCGCGTACTTAATTAGCTAGCTAGGTTCTGGTGTTA
ATTAGTTCCTCATCGATGCATATGTTGATTGCCTTGCTCTGCTTGCGGTTATCTGTAATT
TGGCTTTGCTGCCATGATGAGTACGTGATTGCTGATTTATTTTAC

CDS

699 bp

>Os03t0407400-01 Protein with plant-specific organ size regulation (OSR) domain, transmembrane region, TNFR/NGFR family cysteine-rich domain and VWFC module, Regulator of grain size and organ size
ATGGCAATGGCGGcggcgccccggcccaagtcgccgccggcgccgcccgacccatgcggc
cgccaccgcctccagctcgccgtcgacgcgctccaCCGCGAGATCGGATTCCTCGAGGGT
GAAATAAATTCAATCGAAGGGATCCACGCTGCCTCCAGATGCTGCAGAGAGGTTGACGAA
TTCATCGGAAGAACTCCTGATCCATTCATAACGATTTCATCGGAGAAGCGAAGTCATGAT
CATTCTCACCACTTCTTGAAGAAGTTTCGCTGTTTGTGCAGAGCAAGTGCGTGCTGCCTC
AGCTACCTCTCCTGGATctgctgctgcagcagcgccgccggcggctgctcatcctcctcc
tcctcctccttcaacctcaagaggccgagctgctgctgcaactgcaactgcaactgctgc
tcctcctcctcctcctcATGTGGGGCGGCGTTAACGAAGAGTCCGTGTCGCTGCCGCCGC
CGCAGCTGCTGCTGCCGTCGCTGCTGCTGCGGCGGCGTCGGCGTCCGCGCGTGCGCGAGC
TGCAGCTGCTCCCCGCCGTGCGCGTGCTGCGCGCCGCCGTGCGCGGGATGCTCGTGCCGC
TGCACCTGCCCGTGCCCGTGCCCCGGCGGCTGCTCCTGCGCGTGCCCGGCGTGCAGGTGC
TGCTGCGGCGTCCCTCGTTGCTGCCCCCCCTGCTTGTGA

Protein

233 aa

>Os03t0407400-01 Protein with plant-specific organ size regulation (OSR) domain, transmembrane region, TNFR/NGFR family cysteine-rich domain and VWFC module, Regulator of grain size and organ size
MAMAAAPRPKSPPAPPDPCGRHRLQLAVDALHREIGFLEGEINSIEGIHAASRCCREVDE
FIGRTPDPFITISSEKRSHDHSHHFLKKFRCLCRASACCLSYLSWICCCSSAAGGCSSSS
SSSFNLKRPSCCCNCNCNCCSSSSSSCGAALTKSPCRCRRRSCCCRRCCCGGVGVRACAS
CSCSPPCACCAPPCAGCSCRCTCPCPCPGGCSCACPACRCCCGVPRCCPPCL*

5'UTR

chr03:16735078..16735109 (- strand) : 32 bp

CDS

chr03:16734961..16735077 (- strand) : 117 bp

chr03:16733436..16733488 (- strand) : 53 bp

chr03:16731953..16731997 (- strand) : 45 bp

chr03:16731816..16731869 (- strand) : 54 bp

chr03:16729715..16730144 (- strand) : 430 bp

3'UTR

chr03:16729501..16729714 (- strand) : 214 bp

FASTA

>Os03t0407400-01 class=Sequence position=chr03:16729501..16735109 (- strand)
GATCATCTCC ATTATCGGAA CTTCGGAGTG ACATGGCAAT GGCGGcggcg ccccggccca agtcgccgcc ggcgccgccc
gacccatgcg gccgccaccg cctccagctc gccgtcgacg cgctccaCCG CGAGATCGGA TTCCTCGAGG TACAATCTAT
CTCTATCTGT CTATATCACT ACCATTCATA CTCCTTCGAT CTTGCTTCAA AACAAAAAAA TATATATTTC CTACTTCATA
TTCATATACA CACGTACGGC TTGCTATCTG TCGAATTGTT TGCTTCTGCA TGCATGCATC ACTCTCATTG TAAGTTTTTC
CCAGCTTAAA ACCACTCCTT TTATCTTCGT TCTTCTTCCT TCTTGTTTTT TTTTAAAAAA ACAACAACTC ATTTAATCTT
CATATAGTGT ATCATGCATC ATTTGCTTCT TTGATCAGTT CCCCAAAAAC TGCTCCTCTC TTCCCAGCCA AATAATTAAA
CTTAAGCAAA CAAGCAAGTT GAACTGATGA TCCAATAAAA CAAAACAAAA CCGATCGAAT AGGAAGTCAA TGGCATATAC
CAGCTGCTAT AGCTGAAGCC ACGAATGCTT AGCTTAGCTC TAGTCGATCC CTGTTGACTG TTCAACACAC TGCACTAACA
CACCAGTTAA TGAGCTGATT AATTAAACCA TTAAATGAGC TTAACGGGCG GCTAGCTTCT TCCTCTGGGC CCGTGCCGAT
CGTACCATCG GTTTGCGCGT CCCTCCACCT AAACTCTCTG CCTTGTTATT CCCTTTGCCT AGTACTACAT GCATTTGCAT
CATCATCCCA TCACCAATAG TACTACGTTT CAACTGGATT TTGGTGGTGT CCAACCATAT CATATTTGGT TTTGTTCTCT
AGTTTACTCC TACATTAGTC TCTAGCGGTT TTGTGGAGTA CTAAAGAAAA CAACTAATCA GCCAGGGTTT AACGTTTAAT
CGGTTGGTGG TTTTGTTAAT TAATTTCATC TACTATTTTA GACTTCACAG GTCTTCGAGC TATAAGCATC GATTGCCATG
CATCAATCGA TGCTGGTCCA CGCTAGTTTC TGAGTTCTGA CTAGCTCTCT TAATTGTGCT TTGACCTACT TTAATTAATT
AACCAGTGGC TGCGTCACTC ATTGACCAAC ATTGTCATGT TACCCGGACT GATTTTTTTT TTCTTTAAAA AAACACCGGA
TATATTATTA GTTAGTGTAT ATATATGTCT GCTCAAGAAG CGCATGCATA TAGTTTCTCG TCAAACAAAA AATGTACTGT
ATGCTCAAAG CATCTGTTTT GGAATTGTCA TATTCGCCTT TATAATTAAA ATAATTAAAA TGGTGATGCC CAGCTTTTTT
TTTCCTCCAA TAATTTATTT ATTGGCTTGA TTTCCTGTGC TATTAGGAGT AAAACTACTC CGTTTTAATT AGCACCATTT
TTAAAGCTTC TAAAATTAAC CTAAGTAAAG TACGACAGTA CTTGCTGTCT AGCTTTAAAT GTTTTGGGTG TTAAAATATC
CCTCAGACAT CACCTGAAAA GTTGACAGGC TAAACACATG CCCATCTCCC TCGTTTACTT AAATTAATTC GAACAAACAA
CTGTATATAT ATTTCTTGCA GGGTGAAATA AATTCAATCG AAGGGATCCA CGCTGCCTCC AGATGCTGCA GAGAGTAAGC
CAGCCTGCTG TTTCTTTTTG TACTACTTCC ATTTCTTCTC GTCTTTACTC TTACCATGCA TTCACAAAAT ATACTTACTT
ACCCCAGTTT TTGATCATGA ACTTTGACCG TTATCTTTTT AAGCAACTTC AATAAAATAG GTTTAAATGC AAATGTTATG
TACACCATTG ATTATAAAAC CTTGGCAAAT GAAAGTAAAA AACCAGCACA TTTAATTTCT GAACGTTGGG AGTATTATTA
TTTTTATATC TTTTACTATC ATTTAATCAT AGTATCGTGC AAGCTTTTTG AGTGTAATTA GGTTGCTTAA GGTAAAAAAA
TGTAACTAGG TTACATTTAG TACTAAACTG AACATTTAAT TAGTAATGTT TCGTTAAGTA ACTGTAATTT CAATGCATGC
ATGTCCTCCC Gtaagagcaa gtttaatagt atagccaact actagctcca atttatttat agacaatcta atagctcatt
catacaataa ttacatacta cactattaat atctgatccc acctgtcata cacatactgc attttggagt ccgtgctata
gctgactaca aatctatagt ccgctgctct tctctctctt tatttatctc cttaaaatat gtttgcagct ggcttatagc
ctgctattgt acctgctctg aAAATAGTGC AGAGACTGTT CAAAAAGTCA TTGCACAATA ACTATTCACA TGGAACTGTG
AAAAGTATAT ATTGGAACTT ACTAGCTAGA TCCTTTTGGG AACATGGGAA AAGCCAAGTC ACGTGTGGAA TCCCTATTCC
CTGTGTTCTT CAGCTAGAAG AGTGAAAATA ATGTACTACT ACTATACGGA GATGAAATTA CAGCAGGAGC AGAAAGCGGG
AAAAAAACTT TAAATCAATT AAACAAACCT CTCTCTGCAA AATTCAACAC CAGCAACGAA CAACTCATCA AGTTCTTGTG
TTATGTACCG GCCGGTAACT AATTGttgtt tgcataagcg aaacggtata tttgcaaaca aaaaataatt tatgaataaa
acttttatat acatgttctt aattatctca aaacaaaggt tgaaaaataa acttcgatga aaaaatctca aaatcaattc
caaatttatg gtgaaaattt taaattttgt ctgataaaca taagtataag caaaaaAAAA AGTAAAGCAA TGTCACTATG
TTAATGGTAT TGGTATATAT ACCTTTGAGT TTCTGTCTGT ACTTTAGGAG TACATGCTAC GAACATGTTT TCTTGGCTTC
TATTTCGTTG GAATTACTTG CGTATTGTGG GCCAGACGCC TGGTGAACTT CGTCGATTGT GTGGACTAAT TAAGCTCACC
TGAAATAAGT GGTTGAAAAC AAGGCTAAAG ATGATTTTAA TCATGGATTT TGGCTTGGAA ATTTTTTTGT AGGGTTGACG
AATTCATCGG AAGAACTCCT GATCCATTCA TAACGATGTA TGGATTTTCA GGTCGAGAAT TTGTCTTTAA CTTCGCACGA
CTGTTATTTT TTTTCTTATT AATTCTCTGT TTACAAGCAG TTCATCGGAG AAGCGAAGTC ATGATCATTC TCACCACTTC
TTGAAGAAGT TTCGGTACTC ACTTCATTCC CGGATCTTAA TGTATATATG CATATCTGCA CTGTGCTAAT TGGTGTACAC
ATTATGTGAT CATCAGTCCA AGTTAATTAT TACTTACAAA ACTGAACTAA TAAACACTAG AAAATATGTA ACTTGCAAAG
TACATATTGA ATCAGGGATT CATATATAGA ACTCCACCTG CAGATTTCTT CCAATATATA TATGCTGTCA CCATGTTTTC
ACTTGTCACC TAGTACACCT TTGACTGGGA GACTTTCCTT GATGATCGAC GTGGTCATAT TCTTCAGATT GATTTAATTT
CAGATAGAAA AAAATATTGT TTACTTAGTT TCTCTCCTTC AGTAAGAGAG ATGTGCAAGA CCAGCGATCA AACTATATGA
ACTGTTCGTT TCATGATAAA AAAAACATGA TATGGAATAA CTAGGTGATT CAACATATAA TGGCTGATAA TCCCTCGTTT
CAGGAGATAC CATCAGTTTT CTACTTTTCT ACTTTTCTCC ATGTTCTCTT TTTCATGTTT GAGGTGGATC GGAGCTTGTA
TTAGATGTTT GCTCAGCTCA ATTATTGCTG CAGATTTCCC TATATAGCCT CCACTGTATA TAtactccct ccgattccat
aatttaatga tattttgaac aatgacgctg tctccaaaat atatctttca ctttgttttc ctattataat atatacaata
aaaaaaatac atatttactt ttcttataaa tagtttcaaa gacaaatcta tatatgttgt tatataactc ttttaaacta
aatattttta aagttatagt caaagttaca aaagttggac ctcaaacatg tataaaacgt cgagaattGT ATATCTGATC
AACCAATAAT TTGTAGTGCA TTGTCTTAAA AAAATTGCAT TTCTAGCTAT GTATCTAGAT AATTACAAGA ACCAGGTGAA
ATCACATTTT ATTTTTACTG GACCACGAAC TCATTGTTTA ATTACTTCCA GCCTTGCACT AAATAACAAT AATTGAACCT
GGCATCACCT GCACAATTAA TTTGGACACA AAGTAAACAT GAATGCAACA TACTTCGTTT CATATTGTTT GTTGGTGTAG
GATTTAAATT TTGTGTCAAA ATACTTGCCG TTCTTACTAC ATTCTTAAGC ACTTTGAGAA CTAACCTTCT CTTCCTACCC
TTCATCAATA CAGTCATACT AACTAATTGG CTCTTATGCC TTGAAAAACT AATTAGGATG TATTTAATGA GGGTAACCAT
GTAATCTGCC ACCAGTGAAT GCAATTTTGG TTCAAAATTT CGGGCCCCCG CCCTAAAAAG TCATTATCTC GATAGAATTT
TTTTGAATTT AGTCAAAATT TATTCAAATT TAGCCAAATT GTGTTAAATT TCAAATAATT TCAGTCTAAA AAGTGCTGAA
AATCCCGAAA TTTAGGTTCT ACCGAAATGG CCGGAAATTT TCAGCGAAAA TCAAACATGA AAACCTTGTC TGCCACATTT
GTTAGTTTGT GTAAAGATTT GCTAGAACGA TAAGTAATTT GAAGCGGATG TATATTATAT ATCCCACAAA ACCATCAACT
TGTTAATTAC ATGTATATTT GTGCATGATG CTTTCACCAC TTTGTGGTTG TTAACGATTA AATCACACGT TTTATTTTCT
CACAGCTGTT TGTGCAGAGC AAGTGCGTGC TGCCTCAGCT ACCTCTCCTG GATctgctgc tgcagcagcg ccgccggcgg
ctgctcatcc tcctcctcct cctccttcaa cctcaagagg ccgagctgct gctgcaactg caactgcaac tgctgctcct
cctcctcctc ctcATGTGGG GCGGCGTTAA CGAAGAGTCC GTGTCGCTGC CGCCGCCGCA GCTGCTGCTG CCGTCGCTGC
TGCTGCGGCG GCGTCGGCGT CCGCGCGTGC GCGAGCTGCA GCTGCTCCCC GCCGTGCGCG TGCTGCGCGC CGCCGTGCGC
GGGATGCTCG TGCCGCTGCA CCTGCCCGTG CCCGTGCCCC GGCGGCTGCT CCTGCGCGTG CCCGGCGTGC AGGTGCTGCT
GCGGCGTCCC TCGTTGCTGC CCCCCCTGCT TGTGATCGAT CGATCGATTG AGCGAAGCTG CACTGATTGG TTAATTAATT
AGTTCTCGAT GATGATCGAT CGAGCTGCGC GCGTACTTAA TTAGCTAGCT AGGTTCTGGT GTTAATTAGT TCCTCATCGA
TGCATATGTT GATTGCCTTG CTCTGCTTGC GGTTATCTGT AATTTGGCTT TGCTGCCATG ATGAGTACGT GATTGCTGAT
TTATTTTAC