Os03t0411100-01

Locus

Os03g0411100

Description

Heme activator protein, CCAAT-binding transcription factor, Biotic and abiotic resistances

RAP-DB Gene Symbol Synonym(s)

HAP2E, OsHAP2E, NF-YA, CBF-B

RAP-DB Gene Name Synonym(s)

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

CGSNL Gene Symbol

HAP2E

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2E, NF-YA, CBF-B, NF-YA2, OsNF-YA2, NFYA2

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A2, NUCLEAR FACTOR-Y subunit NF-YA2, NF-YA transcription factor 2, NF-YA subunit 2, NF-YA family 2

Transcript Evidence

AK071595

Protein Evidence

Q852G5

Literature

PMID: 25168932

PMID: 18193457

Note

Manual Curation

April 3, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Cellular Component: CCAAT-binding factor complex (GO:0016602)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

CCAAT-binding factor, conserved site (IPR018362)

Full-length cDNA

J023106F21 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0411100-01)

RiceXPro (AK071595)

Others

Oryzabase (8477)

KEGG (Os03t0411100-01)

Transcript

1630 bp

>Os03t0411100-01 Heme activator protein, CCAAT-binding transcription factor, Biotic and abiotic resistances
AGTACAAAGGAGAGAGAGAGAGAGACTCTAGTGCATATTTGGCAGGAAGAGCCGAAGAGG
GGAGGTGAGGATCAGAGGAGGCAGCCTCATCGTCATGCTTCAGCACTAGTAGTAGTAGTG
CCACCATTTCTTTGCCCTCGATCTTTCCCCAGAGAGAGAGAGAGAGAGAGAGAGAGTCTT
GATTGGGGGAGGAGAGAGGGAGAGAGAGAAAGAGAGAGGACAGAAAATGTTTGTGGATCT
TGAGTAATGCCTTCTAATAATGATAATGCTGTTGCAAGAAATGGAGAATCATCCTGTCCA
ATGCATGGCCAAGACCAACTATGATTTTCTTGCCAGGAATAACTATCCAATGAAACAGTT
AGTTCAGAGGAACTCTGATGGTGACTCGTCACCAACAAAGTCTGGGGAGTCTCACCAAGA
AGCATCTGCAGTAAGTGACAGCAGTCTCAACGGACAACACACCTCACCACAATCAGTGTT
TGTCCCCTCAGATATTAACAACAATGATAGTTGTGGGGAGCGGGACCATGGCACTAAGTC
GGTATTGTCTTTGGGGAACACAGAAGCTGCCTTTCCTCCTTCAAAGTTCGATTACAACCA
GCCTTTTGCATGTGTTTCTTATCCATATGGTACTGATCCATATTATGGTGGAGTATTAAC
AGGATACACTTCACATGCATTTGTTCATCCTCAAATTACTGGTGCTGCAAACTCTAGGAT
GCCATTGCCTGTTGATCCTTCTGTAGAAGAGCCCATATTTGTCAATGCAAAGCAATACAA
TGCGATCCTTAGAAGAAGGCAAACGCGTGCAAAATTGGAGGCCCAAAATAAGGCGGTGAA
AGGTCGGAAGCCTTACCTCCATGAATCTCGACATCATCATGCTATGAAGCGAGCCCGTGG
ATCAGGTGGTCGGTTCCTTACCAAAAAGGAGCTGCTGGAACAGCAGCAGCAGCAGCAGCA
GCAGAAGCCACCACCGGCATCAGCTCAGTCTCCAACAGGTAGAGCCAGAACGAGCGGCGG
TGCCGTTGTCCTTGGCAAGAACCTGTGCCCAGAGAACAGCACATCCTGCTCGCCATCGAC
ACCGACAGGCTCCGAGATCTCCAGCATCTCATTTGGGGGCGGCATGCTGGCTCACCAAGA
GCACATCAGCTTCGCATCCGCTGATCGCCACCCCACAATGAACCAGAACCACCGTGTCCC
CGTCATGAGGTGAAAACCTCGGGATCGCGGGACACGGGCGGTTCTGGTTTACCCTCACTG
GCGCACTCCGGTGTGCCCGTGGCAATTCATCCTTGGCTTATGAAGTATCTACCTGATAAT
AGTCTGCTGTCAGTTTATATGCAATGCAACCTCTGTCAGATAAACTCTTATAGTTTGTTT
TATTGTAAGCTATGACTGAACGAACTGTCGAGCAGATGGCTAATTTGTATGTTGTGGGTA
CAGAAATCCTGAAGCTTTTGATGTACCTAATTGCCTTTTGCTTATACTCTTGGTGTATAC
CCATTACCAAGTTGCCTTAAAAACCCTCCAATTATGTAATCAGTCATGGTTTTATAGAAC
CTTGCCACATGTAATCAATCACCTGTTTTTGTAAATTGATCTATAAACGCTATAGGCTGC
TGTGTTATCT

CDS

954 bp

>Os03t0411100-01 Heme activator protein, CCAAT-binding transcription factor, Biotic and abiotic resistances
ATGATAATGCTGTTGCAAGAAATGGAGAATCATCCTGTCCAATGCATGGCCAAGACCAAC
TATGATTTTCTTGCCAGGAATAACTATCCAATGAAACAGTTAGTTCAGAGGAACTCTGAT
GGTGACTCGTCACCAACAAAGTCTGGGGAGTCTCACCAAGAAGCATCTGCAGTAAGTGAC
AGCAGTCTCAACGGACAACACACCTCACCACAATCAGTGTTTGTCCCCTCAGATATTAAC
AACAATGATAGTTGTGGGGAGCGGGACCATGGCACTAAGTCGGTATTGTCTTTGGGGAAC
ACAGAAGCTGCCTTTCCTCCTTCAAAGTTCGATTACAACCAGCCTTTTGCATGTGTTTCT
TATCCATATGGTACTGATCCATATTATGGTGGAGTATTAACAGGATACACTTCACATGCA
TTTGTTCATCCTCAAATTACTGGTGCTGCAAACTCTAGGATGCCATTGCCTGTTGATCCT
TCTGTAGAAGAGCCCATATTTGTCAATGCAAAGCAATACAATGCGATCCTTAGAAGAAGG
CAAACGCGTGCAAAATTGGAGGCCCAAAATAAGGCGGTGAAAGGTCGGAAGCCTTACCTC
CATGAATCTCGACATCATCATGCTATGAAGCGAGCCCGTGGATCAGGTGGTCGGTTCCTT
ACCAAAAAGGAGCTGCTGGAACAGCAGCAGCAGCAGCAGCAGCAGAAGCCACCACCGGCA
TCAGCTCAGTCTCCAACAGGTAGAGCCAGAACGAGCGGCGGTGCCGTTGTCCTTGGCAAG
AACCTGTGCCCAGAGAACAGCACATCCTGCTCGCCATCGACACCGACAGGCTCCGAGATC
TCCAGCATCTCATTTGGGGGCGGCATGCTGGCTCACCAAGAGCACATCAGCTTCGCATCC
GCTGATCGCCACCCCACAATGAACCAGAACCACCGTGTCCCCGTCATGAGGTGA

Protein

318 aa

>Os03t0411100-01 Heme activator protein, CCAAT-binding transcription factor, Biotic and abiotic resistances
MIMLLQEMENHPVQCMAKTNYDFLARNNYPMKQLVQRNSDGDSSPTKSGESHQEASAVSD
SSLNGQHTSPQSVFVPSDINNNDSCGERDHGTKSVLSLGNTEAAFPPSKFDYNQPFACVS
YPYGTDPYYGGVLTGYTSHAFVHPQITGAANSRMPLPVDPSVEEPIFVNAKQYNAILRRR
QTRAKLEAQNKAVKGRKPYLHESRHHHAMKRARGSGGRFLTKKELLEQQQQQQQQKPPPA
SAQSPTGRARTSGGAVVLGKNLCPENSTSCSPSTPTGSEISSISFGGGMLAHQEHISFAS
ADRHPTMNQNHRVPVMR*

5'UTR

chr03:16965191..16965408 (+ strand) : 218 bp

chr03:16966889..16966929 (+ strand) : 41 bp

CDS

chr03:16966930..16966992 (+ strand) : 63 bp

chr03:16967081..16967234 (+ strand) : 154 bp

chr03:16968868..16968998 (+ strand) : 131 bp

chr03:16969076..16969150 (+ strand) : 75 bp

chr03:16969431..16969598 (+ strand) : 168 bp

chr03:16969953..16970315 (+ strand) : 363 bp

3'UTR

chr03:16970316..16970732 (+ strand) : 417 bp

FASTA

>Os03t0411100-01 class=Sequence position=chr03:16965191..16970732 (+ strand)
AGTACAAAGG AGAGAGAGAG AGAGACTCTA GTGCATATTT GGCAGGAAGA GCCGAAGAGG GGAGGTGAGG ATCAGAGGAG
GCAGCCTCAT CGTCATGCTT CAGCACTAGT AGTAGTAGTG CCACCATTTC TTTGCCCTCG ATCTTTCCCC AGAGAGAGAG
AGAGAGAGAG AGAGAGTCTT GATTGGGGGA GGAGAGAGGG AGAGAGAGAA AGAGAGAGGT ATTCTTCTTG TTCTTGTGCT
TCCACTTGAT TCACTTCCAA ATTTGTTCCC CTTTCAAGAT ATTCTTTCAT GGGGCTGGGT TCCTGGATTA TGGCGCTTGC
ATGTGTCTTG GTAGAAGTTG TTGACTTGCG GCTTTGGGTT GGGTGGGTGT GGATTTGCTT CTTGCTTGCT CATGTCCCCC
CCCCCCTCCA TGTCTTCCTT CTTCTACTTT CAGTTTCAGC TGGATCTCCG CATGATTTGG GGTAAGGGGG AGCATAGCTA
TGTCCCTTGG TTCTTGGTTT GTTACTCTTT CTCTGTATAT GCTGTTCTTT GGTTCAGAAT TTGTTTTGCA TGAACAAAGA
AGTACAACTC GTATGAGGCT TTCAGGAATT TAAGGCTGCT GCTTTGATTT TGTCTGTGGG CTAGCTAGAC TGAGGAGTCT
TGGCTTCACC TTTTCTTTGC TGGATTTGGT GTTCTTTCAA GTTCAAAATC TGGATGGTTT TTCAGTGCTT ACCCCCCTTT
TCTTGGGTAC ATGCTGTGTA CTTTCTTCTC TGCCAATGAA ATGAGACAGA GCTTCTGACT TTGGATGGAC TGTACGGTTC
TTAATTGACA TTTCTGATTT AGTTCTGCGT TAAAGTGGAT GCTTAGGGTA CAGAGGAATT AGTGCCAATA TTTGAAGTTT
CTTTAGCAAG ATTGCCTTTG TGTGATGATA AATAGGTTAT CCTGGTTGAA TTCTTGGCGG ATTTCAGTTG CTATTTCCCC
CCTGAAAAGC GGGAGTTCTC CTAAGTTTGA TGTACTATGC AAACGTGGGA TTTTTTTTTC CGCTGTTTAG TACTTGAAGT
CTTGGAGCAA TCAAAATCTT CTGAATGATT GAGTTGGATC TTCCGTAGGC AAGATAGTAC AGGGAAGTAA TTACTAGAGA
TAGTACATAG TAGAAGTGAT TACTCATTAC TTTAAGTCTC TAACTTAACA GCAACCTTGT GGTTGAAAGT AGTCCTGAAG
AAAGTTTAGC ATCTTGTCGG TCATAGGACA TGCTGATCAT TAGCATCTGA AGTAGCCTAG ATTTGTCACT GTACTTTGCT
CTTGGTCAGC TTTAGGGTGA TTTTTTTTGT GTTCTACATT GGTAACTACC GGTGTGCTAC GCGGACACTG TTTTTTCTTA
TTTATTTTGG ATTAGCCCGG TAGATGATGC TGCTCAGGAG TTCTACTTCT TATCCTGGAG GTGTACTGTC TAGATAGATT
AATCCATCAT AAAGTTGACA TAGTATTGTT TGTTAATGAT ATTGTAGAGG CCGTACAATA GTTCTTTGAT TTATTTTATG
CTTCGATCAT TTTCAACTGT TCATCCAGCT GAGTTTGGAT GTTTGTACAA CCTAATCCCT AATCATTGTA TGTGGATACT
ATACAAACCG AATTCAAGGT ACTAATTTAT CTAGTAACTT GGCTTTCTTT ATGTGCCACT GTCAGTCTGA CCTGAAAATT
TTCTGAACTT CAAAATAGGA CAGAAAATGT TTGTGGATCT TGAGTAATGC CTTCTAATAA TGATAATGCT GTTGCAAGAA
ATGGAGAATC ATCCTGTCCA ATGCATGGCC AAGACCAACT ATGTAAGTAC ATATTCCACA CAGTGTGATA CTGAATCATA
GCTATTAAAC TGAAGATAAT GAACTTACCA ATTCACTTCT ATGTGAATAG GATTTTCTTG CCAGGAATAA CTATCCAATG
AAACAGTTAG TTCAGAGGAA CTCTGATGGT GACTCGTCAC CAACAAAGTC TGGGGAGTCT CACCAAGAAG CATCTGCAGT
AAGTGACAGC AGTCTCAACG GACAACACAC CTCACCACAA TCAGGTAATA CATTTTTCTT CAATGACATC ATCTATACCA
GAAACGCATT CTTTCCCCCA ATCAAATTTT GTGGTGGTTT TGCTTGAAGC CTCGAACTAG TAATTTGCTG TTTCTGGAAA
TACACACACA TGCATGATTG ACTCTCAAGC AGCTAAACAA TTTCTTTTGG TACCTGCTCC TATTATTTCG GTTCAGTGCC
ATATGAGTTA TAAGCTGTAA AGGGAGAATA TTCTGATAAA AAGACTATGA AAGAGAACAA AAAATGCAGT CACCACACAT
AACATGATAG GGTTAAACTT TGTTTCATTG TGAAATTTTT ATGCCAGTGA GAGAAAATGT CGTATTCAAT CTTAGAGGTT
TGGCTAAAAT TGCAGAAACG CAGAATATAT TCTTCTGTGA CTATATCATC CATTTTAAGT TTGAAACAAA AGAAGTATAT
TGCATTTGAA TGATGCTCAT TCACCTATTA TTCCTACTTC CCTGCTTTAT TTTGGTGAAA GATTGTAAAT ATACTATTAC
TTAAGGGCAG ATAAGAGTTT TAATCCATAT CTATTCTAAC CCTAATCCCT ATAGGAATTA ATTTAGATGT GCTTCTGTAT
TATCCCTGCC CATAGCTTTT ACATAGCGTT CATTTGTCTA CTTTCACGTC TGCGGCAACC AGACCTGCTA CAAAACTATG
TAGTCAGAAG AATACACCAA AGAAAAATCT TTGCTTTGGA ATCCATCTGA GCAGCATAGG ACGGAGCAAT GTTTTGGTTT
GGAATGTTGT ATGTAAATTC ACGGGCCTAA ATCATATTTA ATTATGCATC TAATGATATG TTTCTACCCA CATGAAAGAA
ACACTTAGTT TTTCTTCTTG TTGATTGGCC AAGTGGGTGG TTGTTGTATA TAAGTGAAAT AAATCATGCT AGCCTTTCAA
ATGATGATTG TCTCGATCTT GAGCATTATT GCTTTAAAGA TCACGAGTCT TTGCACCTGT AGAACGCTAA AGCAAAATCT
GTTCTTCAAA TGGTCAGGCT TCAAATATAT GGTAATGTAA TTCAGTATGG CGAATTAAGT TGTCACTCTA ATATTTTGAA
AAATACGATA TCTTTGTTAT CCAGAATTAA CAAAATATGA TCTTACGCAG ATTGGTATGT GTGAGATCAC TGTGTGCATT
CCCCCGTGtt cacaattcat gttcttttcc tgtttgtatc aattaggcat ctaaaattct acataataaa tgaaataact
agaGGGTGCA TTATTATGTG ATCAATTCTT ATGCTCTGGG TTATGCTCTT CTTAAAGAGT GGCACATGTA ACCGACTTCA
ATTGTTCGAT TTACTAGCAT ATTGCCCGTG CATTGGTACA GGATTTAAGA AAAGAACACT GTCATCAACC CATGTTGGTC
ATCACATTTT ACCTATTTTC ATCTCTTAAT TTTTGTATAT ACCTTTCAGC TGATAAGTGG GCCCATTGGA CCCACACTCT
TGTTTTTACC TTCGCAAAAA AGCAGGGAAT TGGTGGTGGG GGTGGTGGCA GATTCACCAC AAACCACCAC CATTTGCTTC
TTTTGAAATA GTATAGATAA GAAATCACTT CAGTTTCTAA GGTGAACAAG TGGCTGACAT CACTTATTGT ATGACAGTGT
TTGTCCCCTC AGATATTAAC AACAATGATA GTTGTGGGGA GCGGGACCAT GGCACTAAGT CGGTATTGTC TTTGGGGAAC
ACAGAAGCTG CCTTTCCTCC TTCAAAGTTC GATTACAACC AGCCTTTTGT AAGTTAACAT AATCTTTAGT ACTACTACTA
TGTTTGAACC TTATGTTTAG TTTACCTGTT CTTGTGTTTT TCCAGGCATG TGTTTCTTAT CCATATGGTA CTGATCCATA
TTATGGTGGA GTATTAACAG GATACACTTC ACATGCATTT GTAAGTAAAG ACAGGGCTGT AATTTTCAGC CTCCTTTTGT
TTTATTTTCT TTGTTATTTA TCCAAACAGA AGCAACAAAT GCTTTCAAAT GGAAATGAAA ATTATCCAAA TAGTTCTCAC
CAATTTTATA GGAGAATGCT ACAAATTTAG TTTTTCAAAT AATAATGACA TTTAGTGAGG ACTATGCCCA GTGGAAAAAC
CTAGAAGAAT ATATAGGCAT AGAAGAAAAC CTGCAAAATA TATGTGGTGT GGTATTAAAC TCTTGTGTAT TATCAAACAG
GTTCATCCTC AAATTACTGG TGCTGCAAAC TCTAGGATGC CATTGCCTGT TGATCCTTCT GTAGAAGAGC CCATATTTGT
CAATGCAAAG CAATACAATG CGATCCTTAG AAGAAGGCAA ACGCGTGCAA AATTGGAGGC CCAAAATAAG GCGGTGAAAG
GTCGGAAGGT ATGGCTGAAG CATTTCATAT TTGTTCCTAG CAATCTCTAC AAGCTTGGGC AGTGTCACAT AGTCATATTT
AGATGATTTA ATCCTCCAGG TACTATTCAT TGATTAGTCC TTTTTAGTGA TGTCAGATGT ATCATTTATG CTTGTAACAT
TCCTTTACCT GCAAACATCA ATAGAGGCAG TTACATTTTC TGTAATGATT CGAAATTAAT ATTCTTAGTT TTTGTTTGTA
GCCACTTATG TTTAGTCCTT GTTTGGTTGC ATTTGTTTCC TGCATGCGTG CCTTCCTGCC TGCTGTCTGT AACTACACTT
TTCTATATTG TATTAATAAT TGTGATGCCA TTATGTTCCC AGCCTTACCT CCATGAATCT CGACATCATC ATGCTATGAA
GCGAGCCCGT GGATCAGGTG GTCGGTTCCT TACCAAAAAG GAGCTGCTGG AACAGCAGCA GCAGCAGCAG CAGCAGAAGC
CACCACCGGC ATCAGCTCAG TCTCCAACAG GTAGAGCCAG AACGAGCGGC GGTGCCGTTG TCCTTGGCAA GAACCTGTGC
CCAGAGAACA GCACATCCTG CTCGCCATCG ACACCGACAG GCTCCGAGAT CTCCAGCATC TCATTTGGGG GCGGCATGCT
GGCTCACCAA GAGCACATCA GCTTCGCATC CGCTGATCGC CACCCCACAA TGAACCAGAA CCACCGTGTC CCCGTCATGA
GGTGAAAACC TCGGGATCGC GGGACACGGG CGGTTCTGGT TTACCCTCAC TGGCGCACTC CGGTGTGCCC GTGGCAATTC
ATCCTTGGCT TATGAAGTAT CTACCTGATA ATAGTCTGCT GTCAGTTTAT ATGCAATGCA ACCTCTGTCA GATAAACTCT
TATAGTTTGT TTTATTGTAA GCTATGACTG AACGAACTGT CGAGCAGATG GCTAATTTGT ATGTTGTGGG TACAGAAATC
CTGAAGCTTT TGATGTACCT AATTGCCTTT TGCTTATACT CTTGGTGTAT ACCCATTACC AAGTTGCCTT AAAAACCCTC
CAATTATGTA ATCAGTCATG GTTTTATAGA ACCTTGCCAC ATGTAATCAA TCACCTGTTT TTGTAAATTG ATCTATAAAC
GCTATAGGCT GCTGTGTTAT CT

Locus: Os03g0411100

Loading...

Locus: Os03g0411100

Loading...