Os03t0411100-02

Locus

Os03g0411100

Description

Similar to Nuclear Y/CCAAT-box binding factor A subunit NF-YA.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP2E

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2E, NF-YA, CBF-B, NF-YA2, OsNF-YA2, NFYA2

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A2, NUCLEAR FACTOR-Y subunit NF-YA2, NF-YA transcription factor 2, NF-YA subunit 2, NF-YA family 2

Transcript Evidence

AK062135 (DDBJ, Best hit)

Protein Evidence

A6BLV2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Cellular Component: CCAAT-binding factor complex (GO:0016602)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

CCAAT-binding factor, conserved site (IPR018362)

Full-length cDNA

001-045-F05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0411100-02)

RiceXPro (AK062135)

Others

Oryzabase (8477)

KEGG (Os03t0411100-02)

Transcript

1554 bp

>Os03t0411100-02 Similar to Nuclear Y/CCAAT-box binding factor A subunit NF-YA.
TGCTTCGATCATTTTCAACTGTTCATCCAGCTGAGTTTGGATGTTTGTACAACCTAATCC
CTAATCATTGTATGTGGATACTATACAAACCGAATTCAAGGTACTAATTTATCTAGTAAC
TTGGCTTTCTTTATGTGCCACTGTCAGTCTGACCTGAAAATTTTCTGAACTTCAAAATAG
GACAGAAAATGTTTGTGGATCTTGAGTAATGCCTTCTAATAATGATAATGCTGTTGCAAG
AAATGGAGAATCATCCTGTCCAATGCATGGCCAAGACCAACTATGATTTTCTTGCCAGGA
ATAACTATCCAATGAAACAGTTAGTTCAGAGGAACTCTGATGGTGACTCGTCACCAACAA
AGTCTGGGGAGTCTCACCAAGAAGCATCTGCAGTAAGTGACAGCAGTCTCAACGGACAAC
ACACCTCACCACAATCAGTGTTTGTCCCCTCAGATATTAACAACAATGATAGTTGTGGGG
AGCGGGACCATGGCACTAAGTCGGTATTGTCTTTGGGGAACACAGAAGCTGCCTTTCCTC
CTTCAAAGTTCGATTACAACCAGCCTTTTGCATGTGTTTCTTATCCATATGGTACTGATC
CATATTATGGTGGAGTATTAACAGGATACACTTCACATGCATTTGTTCATCCTCAAATTA
CTGGTGCTGCAAACTCTAGGATGCCATTGCCTGTTGATCCTTCTGTAGAAGAGCCCATAT
TTGTCAATGCAAAGCAATACAATGCGATCCTTAGAAGAAGGCAAACGCGTGCAAAATTGG
AGGCCCAAAATAAGGCGGTGAAAGGTCGGAAGCCTTACCTCCATGAATCTCGACATCATC
ATGCTATGAAGCGAGCCCGTGGATCAGGTGGTCGGTTCCTTACCAAAAAGGAGCTGCTGG
AACAGCAGCAGCAGCAGCAGCAGCAGAAGCCACCACCGGCATCAGCTCAGTCTCCAACAG
GTAGAGCCAGAACGAGCGGCGGTGCCGTTGTCCTTGGCAAGAACCTGTGCCCAGAGAACA
GCACATCCTGCTCGCCATCGACACCGACAGGCTCCGAGATCTCCAGCATCTCATTTGGGG
GCGGCATGCTGGCTCACCAAGAGCACATCAGCTTCGCATCCGCTGATCGCCACCCCACAA
TGAACCAGAACCACCGTGTCCCCGTCATGAGGTGAAAACCTCGGGATCGCGGGACACGGG
CGGTTCTGGTTTACCCTCACTGGCGCACTCCGGTGTGCCCGTGGCAATTCATCCTTGGCT
TATGAAGTATCTACCTGATAATAGTCTGCTGTCAGTTTATATGCAATGCAACCTCTGTCA
GATAAACTCTTATAGTTTGTTTTATTGTAAGCTATGACTGAACGAACTGTCGAGCAGATG
GCTAATTTGTATGTTGTGGGTACAGAAATCCTGAAGCTTTTGATGTACCTAATTGCCTTT
TGCTTATACTCTTGGTGTATACCCATTACCAAGTTGCCTTAAAAACCCTCCAATTATGTA
ATCAGTCATGGTTTTATAGAACCTTGCCACATGTAATCAATCACCTGTTTTTGT

CDS

954 bp

>Os03t0411100-02 Similar to Nuclear Y/CCAAT-box binding factor A subunit NF-YA.
ATGATAATGCTGTTGCAAGAAATGGAGAATCATCCTGTCCAATGCATGGCCAAGACCAAC
TATGATTTTCTTGCCAGGAATAACTATCCAATGAAACAGTTAGTTCAGAGGAACTCTGAT
GGTGACTCGTCACCAACAAAGTCTGGGGAGTCTCACCAAGAAGCATCTGCAGTAAGTGAC
AGCAGTCTCAACGGACAACACACCTCACCACAATCAGTGTTTGTCCCCTCAGATATTAAC
AACAATGATAGTTGTGGGGAGCGGGACCATGGCACTAAGTCGGTATTGTCTTTGGGGAAC
ACAGAAGCTGCCTTTCCTCCTTCAAAGTTCGATTACAACCAGCCTTTTGCATGTGTTTCT
TATCCATATGGTACTGATCCATATTATGGTGGAGTATTAACAGGATACACTTCACATGCA
TTTGTTCATCCTCAAATTACTGGTGCTGCAAACTCTAGGATGCCATTGCCTGTTGATCCT
TCTGTAGAAGAGCCCATATTTGTCAATGCAAAGCAATACAATGCGATCCTTAGAAGAAGG
CAAACGCGTGCAAAATTGGAGGCCCAAAATAAGGCGGTGAAAGGTCGGAAGCCTTACCTC
CATGAATCTCGACATCATCATGCTATGAAGCGAGCCCGTGGATCAGGTGGTCGGTTCCTT
ACCAAAAAGGAGCTGCTGGAACAGCAGCAGCAGCAGCAGCAGCAGAAGCCACCACCGGCA
TCAGCTCAGTCTCCAACAGGTAGAGCCAGAACGAGCGGCGGTGCCGTTGTCCTTGGCAAG
AACCTGTGCCCAGAGAACAGCACATCCTGCTCGCCATCGACACCGACAGGCTCCGAGATC
TCCAGCATCTCATTTGGGGGCGGCATGCTGGCTCACCAAGAGCACATCAGCTTCGCATCC
GCTGATCGCCACCCCACAATGAACCAGAACCACCGTGTCCCCGTCATGAGGTGA

Protein

318 aa

>Os03t0411100-02 Similar to Nuclear Y/CCAAT-box binding factor A subunit NF-YA.
MIMLLQEMENHPVQCMAKTNYDFLARNNYPMKQLVQRNSDGDSSPTKSGESHQEASAVSD
SSLNGQHTSPQSVFVPSDINNNDSCGERDHGTKSVLSLGNTEAAFPPSKFDYNQPFACVS
YPYGTDPYYGGVLTGYTSHAFVHPQITGAANSRMPLPVDPSVEEPIFVNAKQYNAILRRR
QTRAKLEAQNKAVKGRKPYLHESRHHHAMKRARGSGGRFLTKKELLEQQQQQQQQKPPPA
SAQSPTGRARTSGGAVVLGKNLCPENSTSCSPSTPTGSEISSISFGGGMLAHQEHISFAS
ADRHPTMNQNHRVPVMR*

5'UTR

chr03:16966709..16966929 (+ strand) : 221 bp

CDS

chr03:16966930..16966992 (+ strand) : 63 bp

chr03:16967081..16967234 (+ strand) : 154 bp

chr03:16968868..16968998 (+ strand) : 131 bp

chr03:16969076..16969150 (+ strand) : 75 bp

chr03:16969431..16969598 (+ strand) : 168 bp

chr03:16969953..16970315 (+ strand) : 363 bp

3'UTR

chr03:16970316..16970694 (+ strand) : 379 bp

FASTA

>Os03t0411100-02 class=Sequence position=chr03:16966709..16970694 (+ strand)
TGCTTCGATC ATTTTCAACT GTTCATCCAG CTGAGTTTGG ATGTTTGTAC AACCTAATCC CTAATCATTG TATGTGGATA
CTATACAAAC CGAATTCAAG GTACTAATTT ATCTAGTAAC TTGGCTTTCT TTATGTGCCA CTGTCAGTCT GACCTGAAAA
TTTTCTGAAC TTCAAAATAG GACAGAAAAT GTTTGTGGAT CTTGAGTAAT GCCTTCTAAT AATGATAATG CTGTTGCAAG
AAATGGAGAA TCATCCTGTC CAATGCATGG CCAAGACCAA CTATGTAAGT ACATATTCCA CACAGTGTGA TACTGAATCA
TAGCTATTAA ACTGAAGATA ATGAACTTAC CAATTCACTT CTATGTGAAT AGGATTTTCT TGCCAGGAAT AACTATCCAA
TGAAACAGTT AGTTCAGAGG AACTCTGATG GTGACTCGTC ACCAACAAAG TCTGGGGAGT CTCACCAAGA AGCATCTGCA
GTAAGTGACA GCAGTCTCAA CGGACAACAC ACCTCACCAC AATCAGGTAA TACATTTTTC TTCAATGACA TCATCTATAC
CAGAAACGCA TTCTTTCCCC CAATCAAATT TTGTGGTGGT TTTGCTTGAA GCCTCGAACT AGTAATTTGC TGTTTCTGGA
AATACACACA CATGCATGAT TGACTCTCAA GCAGCTAAAC AATTTCTTTT GGTACCTGCT CCTATTATTT CGGTTCAGTG
CCATATGAGT TATAAGCTGT AAAGGGAGAA TATTCTGATA AAAAGACTAT GAAAGAGAAC AAAAAATGCA GTCACCACAC
ATAACATGAT AGGGTTAAAC TTTGTTTCAT TGTGAAATTT TTATGCCAGT GAGAGAAAAT GTCGTATTCA ATCTTAGAGG
TTTGGCTAAA ATTGCAGAAA CGCAGAATAT ATTCTTCTGT GACTATATCA TCCATTTTAA GTTTGAAACA AAAGAAGTAT
ATTGCATTTG AATGATGCTC ATTCACCTAT TATTCCTACT TCCCTGCTTT ATTTTGGTGA AAGATTGTAA ATATACTATT
ACTTAAGGGC AGATAAGAGT TTTAATCCAT ATCTATTCTA ACCCTAATCC CTATAGGAAT TAATTTAGAT GTGCTTCTGT
ATTATCCCTG CCCATAGCTT TTACATAGCG TTCATTTGTC TACTTTCACG TCTGCGGCAA CCAGACCTGC TACAAAACTA
TGTAGTCAGA AGAATACACC AAAGAAAAAT CTTTGCTTTG GAATCCATCT GAGCAGCATA GGACGGAGCA ATGTTTTGGT
TTGGAATGTT GTATGTAAAT TCACGGGCCT AAATCATATT TAATTATGCA TCTAATGATA TGTTTCTACC CACATGAAAG
AAACACTTAG TTTTTCTTCT TGTTGATTGG CCAAGTGGGT GGTTGTTGTA TATAAGTGAA ATAAATCATG CTAGCCTTTC
AAATGATGAT TGTCTCGATC TTGAGCATTA TTGCTTTAAA GATCACGAGT CTTTGCACCT GTAGAACGCT AAAGCAAAAT
CTGTTCTTCA AATGGTCAGG CTTCAAATAT ATGGTAATGT AATTCAGTAT GGCGAATTAA GTTGTCACTC TAATATTTTG
AAAAATACGA TATCTTTGTT ATCCAGAATT AACAAAATAT GATCTTACGC AGATTGGTAT GTGTGAGATC ACTGTGTGCA
TTCCCCCGTG ttcacaattc atgttctttt cctgtttgta tcaattaggc atctaaaatt ctacataata aatgaaataa
ctagaGGGTG CATTATTATG TGATCAATTC TTATGCTCTG GGTTATGCTC TTCTTAAAGA GTGGCACATG TAACCGACTT
CAATTGTTCG ATTTACTAGC ATATTGCCCG TGCATTGGTA CAGGATTTAA GAAAAGAACA CTGTCATCAA CCCATGTTGG
TCATCACATT TTACCTATTT TCATCTCTTA ATTTTTGTAT ATACCTTTCA GCTGATAAGT GGGCCCATTG GACCCACACT
CTTGTTTTTA CCTTCGCAAA AAAGCAGGGA ATTGGTGGTG GGGGTGGTGG CAGATTCACC ACAAACCACC ACCATTTGCT
TCTTTTGAAA TAGTATAGAT AAGAAATCAC TTCAGTTTCT AAGGTGAACA AGTGGCTGAC ATCACTTATT GTATGACAGT
GTTTGTCCCC TCAGATATTA ACAACAATGA TAGTTGTGGG GAGCGGGACC ATGGCACTAA GTCGGTATTG TCTTTGGGGA
ACACAGAAGC TGCCTTTCCT CCTTCAAAGT TCGATTACAA CCAGCCTTTT GTAAGTTAAC ATAATCTTTA GTACTACTAC
TATGTTTGAA CCTTATGTTT AGTTTACCTG TTCTTGTGTT TTTCCAGGCA TGTGTTTCTT ATCCATATGG TACTGATCCA
TATTATGGTG GAGTATTAAC AGGATACACT TCACATGCAT TTGTAAGTAA AGACAGGGCT GTAATTTTCA GCCTCCTTTT
GTTTTATTTT CTTTGTTATT TATCCAAACA GAAGCAACAA ATGCTTTCAA ATGGAAATGA AAATTATCCA AATAGTTCTC
ACCAATTTTA TAGGAGAATG CTACAAATTT AGTTTTTCAA ATAATAATGA CATTTAGTGA GGACTATGCC CAGTGGAAAA
ACCTAGAAGA ATATATAGGC ATAGAAGAAA ACCTGCAAAA TATATGTGGT GTGGTATTAA ACTCTTGTGT ATTATCAAAC
AGGTTCATCC TCAAATTACT GGTGCTGCAA ACTCTAGGAT GCCATTGCCT GTTGATCCTT CTGTAGAAGA GCCCATATTT
GTCAATGCAA AGCAATACAA TGCGATCCTT AGAAGAAGGC AAACGCGTGC AAAATTGGAG GCCCAAAATA AGGCGGTGAA
AGGTCGGAAG GTATGGCTGA AGCATTTCAT ATTTGTTCCT AGCAATCTCT ACAAGCTTGG GCAGTGTCAC ATAGTCATAT
TTAGATGATT TAATCCTCCA GGTACTATTC ATTGATTAGT CCTTTTTAGT GATGTCAGAT GTATCATTTA TGCTTGTAAC
ATTCCTTTAC CTGCAAACAT CAATAGAGGC AGTTACATTT TCTGTAATGA TTCGAAATTA ATATTCTTAG TTTTTGTTTG
TAGCCACTTA TGTTTAGTCC TTGTTTGGTT GCATTTGTTT CCTGCATGCG TGCCTTCCTG CCTGCTGTCT GTAACTACAC
TTTTCTATAT TGTATTAATA ATTGTGATGC CATTATGTTC CCAGCCTTAC CTCCATGAAT CTCGACATCA TCATGCTATG
AAGCGAGCCC GTGGATCAGG TGGTCGGTTC CTTACCAAAA AGGAGCTGCT GGAACAGCAG CAGCAGCAGC AGCAGCAGAA
GCCACCACCG GCATCAGCTC AGTCTCCAAC AGGTAGAGCC AGAACGAGCG GCGGTGCCGT TGTCCTTGGC AAGAACCTGT
GCCCAGAGAA CAGCACATCC TGCTCGCCAT CGACACCGAC AGGCTCCGAG ATCTCCAGCA TCTCATTTGG GGGCGGCATG
CTGGCTCACC AAGAGCACAT CAGCTTCGCA TCCGCTGATC GCCACCCCAC AATGAACCAG AACCACCGTG TCCCCGTCAT
GAGGTGAAAA CCTCGGGATC GCGGGACACG GGCGGTTCTG GTTTACCCTC ACTGGCGCAC TCCGGTGTGC CCGTGGCAAT
TCATCCTTGG CTTATGAAGT ATCTACCTGA TAATAGTCTG CTGTCAGTTT ATATGCAATG CAACCTCTGT CAGATAAACT
CTTATAGTTT GTTTTATTGT AAGCTATGAC TGAACGAACT GTCGAGCAGA TGGCTAATTT GTATGTTGTG GGTACAGAAA
TCCTGAAGCT TTTGATGTAC CTAATTGCCT TTTGCTTATA CTCTTGGTGT ATACCCATTA CCAAGTTGCC TTAAAAACCC
TCCAATTATG TAATCAGTCA TGGTTTTATA GAACCTTGCC ACATGTAATC AATCACCTGT TTTTGT

Locus: Os03g0411100

Loading...

Locus: Os03g0411100

Loading...