Os03t0413000-01

Locus

Os03g0413000

Description

Similar to Potential histone-like transcription factor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP3I

CGSNL Gene Name

HAP3I SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3I, NF-YB, CBF-A, NF-YB8, OsNF-YB8, NFYB8

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit B8, NUCLEAR FACTOR-Y subunit NF-YB8, NF-YB subunit 8, NF-YB family 8

Transcript Evidence

AK060225 (DDBJ, Best hit)

Protein Evidence

Q6YNK1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Transcription factor, CBFA/NFYB, DNA topoisomerase (IPR003957)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

001-002-G06 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0413000-01)

RiceXPro (AK060225)

Others

Oryzabase (8488)

KEGG (Os03t0413000-01)

Transcript

1065 bp

>Os03t0413000-01 Similar to Potential histone-like transcription factor.
AGACTAGTCAGTCTCTCCCAAGAACACCCACTCCTCTAGTCTCTCTCGAGAGAGAGAGAA
AATTGATGATTCTTGGGATGATTTTGAGGCGTCTGATTTGCTGAAGAGGAGGAGGAGGAT
GCCGGACTCGGACAACGACTCCGGCGGGCCGAGCAACTACGCGGGAGGGGAGCTGTCGTC
GCCGCGGGAGCAGGACAGGTTCCTGCCGATCGCGAACGTGAGCAGGATCATGAAGAAGGC
GCTGCCGGCGAACGCCAAGATCAGCAAGGACGCCAAGGAGACGGTGCAGGAGTGCGTCTC
CGAGTTCATCTCCTTCATCACCGGCGAGGCCTCCGACAAGTGCCAGCGCGAGAAGCGCAA
GACCATCAACGGCGACGACCTGCTCTGGGCCATGACCACCCTCGGCTTCGAGGACTACGT
CGACCCCCTCAAGCACTACCTCCACAAGTTCCGCGAGATCGAGGGCGAGCGCGCCGCCGC
CTCCACCACCGGCGCCGGCACCAGCGCCGCCTCCACCACGCCGCCGCAGCAGCAGCACAC
CGCCAATGCCGCCGGCGGCTACGCCGGGTACGCCGCCCCGGGAGCCGGCCCCGGCGGCAT
GATGATGATGATGGGGCAGCCCATGTACGGCTCGCCGCCACCGCCGCCACAGCAGCAGCA
GCAGCAACACCACCACATGGCAATGGGAGGAAGAGGCGGCTTCGGTCATCATCCCGGCGG
CGGCGGCGGCGGGTCGTCGTCGTCGTCGGGGCACGGTCGGCAAAACAGGGGCGCTTGACA
TCGCTCCGAGACGAGTAGCATGCACCATGGTACATATATACAGTAATCAGCAGCTGTTCA
TTTTTCTATGATTACTAGTTGACTTAAGCTTGCAAATTTGCTAATCTGAGCTCCTGAGTT
TTTTTTTTTGGTCAGCAATTTCAAGATGGTCAGAAGCTAAATTTGTCTATTTGTTACTGA
TAAATTATTTGTTCTCTCCGTTTAATCGTCATGAAATGTTTTGGGAAACATGAACTTTTC
ATGCCCCTTTTTTAATATAGATTAAGAATCCAGCCTTTACACCAC

CDS

660 bp

>Os03t0413000-01 Similar to Potential histone-like transcription factor.
ATGCCGGACTCGGACAACGACTCCGGCGGGCCGAGCAACTACGCGGGAGGGGAGCTGTCG
TCGCCGCGGGAGCAGGACAGGTTCCTGCCGATCGCGAACGTGAGCAGGATCATGAAGAAG
GCGCTGCCGGCGAACGCCAAGATCAGCAAGGACGCCAAGGAGACGGTGCAGGAGTGCGTC
TCCGAGTTCATCTCCTTCATCACCGGCGAGGCCTCCGACAAGTGCCAGCGCGAGAAGCGC
AAGACCATCAACGGCGACGACCTGCTCTGGGCCATGACCACCCTCGGCTTCGAGGACTAC
GTCGACCCCCTCAAGCACTACCTCCACAAGTTCCGCGAGATCGAGGGCGAGCGCGCCGCC
GCCTCCACCACCGGCGCCGGCACCAGCGCCGCCTCCACCACGCCGCCGCAGCAGCAGCAC
ACCGCCAATGCCGCCGGCGGCTACGCCGGGTACGCCGCCCCGGGAGCCGGCCCCGGCGGC
ATGATGATGATGATGGGGCAGCCCATGTACGGCTCGCCGCCACCGCCGCCACAGCAGCAG
CAGCAGCAACACCACCACATGGCAATGGGAGGAAGAGGCGGCTTCGGTCATCATCCCGGC
GGCGGCGGCGGCGGGTCGTCGTCGTCGTCGGGGCACGGTCGGCAAAACAGGGGCGCTTGA

Protein

220 aa

>Os03t0413000-01 Similar to Potential histone-like transcription factor.
MPDSDNDSGGPSNYAGGELSSPREQDRFLPIANVSRIMKKALPANAKISKDAKETVQECV
SEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAA
ASTTGAGTSAASTTPPQQQHTANAAGGYAGYAAPGAGPGGMMMMMGQPMYGSPPPPPQQQ
QQQHHHMAMGGRGGFGHHPGGGGGGSSSSSGHGRQNRGA*

5'UTR

chr03:17085270..17085387 (+ strand) : 118 bp

CDS

chr03:17085388..17086047 (+ strand) : 660 bp

3'UTR

chr03:17086048..17086334 (+ strand) : 287 bp

FASTA

>Os03t0413000-01 class=Sequence position=chr03:17085270..17086334 (+ strand)
AGACTAGTCA GTCTCTCCCA AGAACACCCA CTCCTCTAGT CTCTCTCGAG AGAGAGAGAA AATTGATGAT TCTTGGGATG
ATTTTGAGGC GTCTGATTTG CTGAAGAGGA GGAGGAGGAT GCCGGACTCG GACAACGACT CCGGCGGGCC GAGCAACTAC
GCGGGAGGGG AGCTGTCGTC GCCGCGGGAG CAGGACAGGT TCCTGCCGAT CGCGAACGTG AGCAGGATCA TGAAGAAGGC
GCTGCCGGCG AACGCCAAGA TCAGCAAGGA CGCCAAGGAG ACGGTGCAGG AGTGCGTCTC CGAGTTCATC TCCTTCATCA
CCGGCGAGGC CTCCGACAAG TGCCAGCGCG AGAAGCGCAA GACCATCAAC GGCGACGACC TGCTCTGGGC CATGACCACC
CTCGGCTTCG AGGACTACGT CGACCCCCTC AAGCACTACC TCCACAAGTT CCGCGAGATC GAGGGCGAGC GCGCCGCCGC
CTCCACCACC GGCGCCGGCA CCAGCGCCGC CTCCACCACG CCGCCGCAGC AGCAGCACAC CGCCAATGCC GCCGGCGGCT
ACGCCGGGTA CGCCGCCCCG GGAGCCGGCC CCGGCGGCAT GATGATGATG ATGGGGCAGC CCATGTACGG CTCGCCGCCA
CCGCCGCCAC AGCAGCAGCA GCAGCAACAC CACCACATGG CAATGGGAGG AAGAGGCGGC TTCGGTCATC ATCCCGGCGG
CGGCGGCGGC GGGTCGTCGT CGTCGTCGGG GCACGGTCGG CAAAACAGGG GCGCTTGACA TCGCTCCGAG ACGAGTAGCA
TGCACCATGG TACATATATA CAGTAATCAG CAGCTGTTCA TTTTTCTATG ATTACTAGTT GACTTAAGCT TGCAAATTTG
CTAATCTGAG CTCCTGAGTT TTTTTTTTTG GTCAGCAATT TCAAGATGGT CAGAAGCTAA ATTTGTCTAT TTGTTACTGA
TAAATTATTT GTTCTCTCCG TTTAATCGTC ATGAAATGTT TTGGGAAACA TGAACTTTTC ATGCCCCTTT TTTAATATAG
ATTAAGAATC CAGCCTTTAC ACCAC