Os03t0424800-00

Locus

Os03g0424800

Description

Similar to 40S ribosomal protein S19-3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Ribosomal protein S19

Transcript Evidence

CT828071 (DDBJ, Best hit)

Protein Evidence

P40978 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translation (GO:0006412)

Cellular Component: intracellular (GO:0005622)

Cellular Component: ribosome (GO:0005840)

Molecular Function: structural constituent of ribosome (GO:0003735)

Functional domain (InterPro)

Ribosomal protein S19e (IPR001266)

Ribosomal protein S19e, conserved site (IPR018277)

Expression Databases

TENOR (Os03t0424800-00)

Others

Oryzabase (17756)

KEGG (Os03t0424800-00)

Transcript

714 bp

>Os03t0424800-00 Similar to 40S ribosomal protein S19-3.
CGGCGGCGGCGGGATGGCGGATTCGACGGCGAGGACGGTGAAGGACGTGAACCCTCATGA
GTTCGTCAAGGCCTACTCCGCCCACCTCAAGCGCTCCGGCAAGATGGAGCTCCCTGAGTG
GGTTGACATCGTGAAGACTGCGAGGTTCAAGGAGCTCCCTCCTTATGATCCGGACTGGTA
CTACACGAGGGCTGCCTCGATTGCAAGGAAGATCTACCTGAGGCAGGGTATTGGTGTAGG
TGGCTTCCAGAAGATCTATGGTGGCCGCCAGAGGAACGGCTCACGCCCCCCGCACTTCTG
CAAGAGCAGCGGCGCTATCTCACGCAACATCCTTCAGCAGCTGCAGAAGATGGGCATCAT
TGATGTCGACCCGAAGGGTGGAAGACTCATCACCTCCCAGGGAAGGCGTGATCTGGACCA
AGTGGCCGGAAGAGTTGATGTTACCATCGCCTGAACAGATCCATTGATCCTCAACCCTTA
ATGCCTGTCATGTTTGGTGGTTGAGTTGGCTACAGTTTGTTTGCAGTTTTGAATTAGAAC
ATGCCCTATCTTTGTTGGCTCAGAGAATTGGAAGTTGGATGCATCTAGTTATGATATTGC
AGTATGTGTTTTTTGTCTTTTGCTGAATGAACTCCTAATGCACTGTCACTAGTTCCGGAC
AAAAGAAAATTAAATTATGCCAATGGAATGTCTCTGCTGATGCCAGTTTTATTC

CDS

441 bp

>Os03t0424800-00 Similar to 40S ribosomal protein S19-3.
ATGGCGGATTCGACGGCGAGGACGGTGAAGGACGTGAACCCTCATGAGTTCGTCAAGGCC
TACTCCGCCCACCTCAAGCGCTCCGGCAAGATGGAGCTCCCTGAGTGGGTTGACATCGTG
AAGACTGCGAGGTTCAAGGAGCTCCCTCCTTATGATCCGGACTGGTACTACACGAGGGCT
GCCTCGATTGCAAGGAAGATCTACCTGAGGCAGGGTATTGGTGTAGGTGGCTTCCAGAAG
ATCTATGGTGGCCGCCAGAGGAACGGCTCACGCCCCCCGCACTTCTGCAAGAGCAGCGGC
GCTATCTCACGCAACATCCTTCAGCAGCTGCAGAAGATGGGCATCATTGATGTCGACCCG
AAGGGTGGAAGACTCATCACCTCCCAGGGAAGGCGTGATCTGGACCAAGTGGCCGGAAGA
GTTGATGTTACCATCGCCTGA

Protein

147 aa

>Os03t0424800-00 Similar to 40S ribosomal protein S19-3.
MADSTARTVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRA
ASIARKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVDP
KGGRLITSQGRRDLDQVAGRVDVTIA*

5'UTR

chr03:17727085..17727097 (+ strand) : 13 bp

CDS

chr03:17727098..17727187 (+ strand) : 90 bp

chr03:17727996..17728086 (+ strand) : 91 bp

chr03:17728232..17728415 (+ strand) : 184 bp

chr03:17728500..17728575 (+ strand) : 76 bp

3'UTR

chr03:17728576..17728835 (+ strand) : 260 bp

FASTA

>Os03t0424800-00 class=Sequence position=chr03:17727085..17728835 (+ strand)
CGGCGGCGGC GGGATGGCGG ATTCGACGGC GAGGACGGTG AAGGACGTGA ACCCTCATGA GTTCGTCAAG GCCTACTCCG
CCCACCTCAA GCGCTCCGGC AAGGTAAGCA ACCGACCAAC CAATCATCCA GGCCCTTACC TTGCGCTTTC CACGCAGATC
CGAGTTCTTG GTATATCATG GATGGGATGT GGTCGCCCCC GCCTCTATGG AGATTCGGTG TTGCTAAGCC TTGTGCGGAT
GCAATCACGG TTTCCTTTTG CTGCTGCGGC TTAGCTTAGG GACAAGCATC CGATCTGTTC GTTACGTTGA TGTTGGATGC
GCCGTTGCTT AGTGTAGTTG TGTCCTTCAT TTCGTTTACG TTGATGTTGA TGCGGCGTTG CAGTATGTTG ATTTTTCGTG
ATTAGGTTAT GTGATTGAGA TCTCGACTCT AATTTGGACA GTTGTTTGTA GCCAGCCAGG AGCTCCTGTT GTTAGGCAAC
CTTCGAATAT CTTTTTACCA GGTCGTCCTG TGTTTTACTT GTTCTTTTGT GTTGAGCTAA ATACTCTTTA TTGTCAAGAT
GTGGTTTATT GTTGGTTAAG CATGCATAAA AATGTTTCAC GTTAAGTCAT AAGAAATGTA ATGTGATGAT ATTTGACTAC
TGCTGCATGA AGTCCTTGCA TACCGCTTGT TGTGGAATAT TCACGCTGGT CACAAATTCC GTGATTATCT ATTCTGTTTA
GTTTCATGTT AAATATATTC TTTGTTGCAC TGTGCTGTGG ACTTTAGTTG GCACTCTTGA TGCTATAAAA GAAATAAAGC
TTTGTAATTA TATTACCGTC AAATTACAAC TACGATCGGA AACCATTTAC ATCAATTGGC CTTTGTGTAT GTTCTTTGTT
CTAAGTTTTG ACAATTAAAA TTCTCTTTTA GATGGAGCTC CCTGAGTGGG TTGACATCGT GAAGACTGCG AGGTTCAAGG
AGCTCCCTCC TTATGATCCG GACTGGTACT ACACGAGGGC TGGTGAGTAT CCTTTTCTTT TACAGCATTC ATGTTCCTTT
GTCAACATGA ATGCCTGGCT GTCGCACTTT CTTTTAAGGA ATCACAGCGA GGGATCTGAG CATAACACTG TTAATATGAT
TGTGACTTTG TTGCTTGTTT TCTGTAGCCT CGATTGCAAG GAAGATCTAC CTGAGGCAGG GTATTGGTGT AGGTGGCTTC
CAGAAGATCT ATGGTGGCCG CCAGAGGAAC GGCTCACGCC CCCCGCACTT CTGCAAGAGC AGCGGCGCTA TCTCACGCAA
CATCCTTCAG CAGCTGCAGA AGATGGGCAT CATTGATGTC GACCCGAAGG GGTAATTTTC AAGTGCTTTC TTGGCGTATC
TTATGTTGTA ATGATGATTG TGTGCTAATC TATGTGTTGT GCTGATCAAC TGCAGTGGAA GACTCATCAC CTCCCAGGGA
AGGCGTGATC TGGACCAAGT GGCCGGAAGA GTTGATGTTA CCATCGCCTG AACAGATCCA TTGATCCTCA ACCCTTAATG
CCTGTCATGT TTGGTGGTTG AGTTGGCTAC AGTTTGTTTG CAGTTTTGAA TTAGAACATG CCCTATCTTT GTTGGCTCAG
AGAATTGGAA GTTGGATGCA TCTAGTTATG ATATTGCAGT ATGTGTTTTT TGTCTTTTGC TGAATGAACT CCTAATGCAC
TGTCACTAGT TCCGGACAAA AGAAAATTAA ATTATGCCAA TGGAATGTCT CTGCTGATGC CAGTTTTATT C