Os03t0433200-01

Locus

Os03g0433200

Description

SHR transcription factor, Regulation of the number of cortex cell layers in the root, Coordination of stomatal patterning

RAP-DB Gene Symbol Synonym(s)

OsSHR2

RAP-DB Gene Name Synonym(s)

SHORTROOT2

CGSNL Gene Symbol

SHR2

CGSNL Gene Name

SHORT ROOT GENE 2

Oryzabase Gene Symbol Synonym(s)

OsSHR2, OsGRAS-15, OsGRAS15, GRAS-15, GRAS15

Oryzabase Gene Name Synonym(s)

rice SHORT ROOT gene2, SHORT-ROOT 2, SHORTROOT2, SHORT-ROOT protein 2, GRAS protein 15

Transcript Evidence

Inferred from literature

Protein Evidence

Q75I13

Literature

PMID: 29127261

PMID: 25352666

PMID: 17446396

Note

Manual Curation

February 20, 2018

Functional domain (InterPro)

Transcription factor GRAS (IPR005202)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytoplasm (GO:0005737) [stele cell]

Expression Databases

TENOR (Os03t0433200-00)

Others

Oryzabase (18668)

Transcript

2475 bp

>Os03t0433200-01 SHR transcription factor, Regulation of the number of cortex cell layers in the root, Coordination of stomatal patterning
CACAACTAGCTAGTTTAGATCCCCTTTGCATCCATCGATGATCAGTTGTTGCAGGACAGT
GTAGTGAGGTGAGAAAGATTGTTGTAGTAGCTGCTGTGCTGTATGGTGGTAGCCAGTGAG
TAGCTACTACACTGCACTGCAGTTTGCACCCCGGCCATATGTTGGCTACTACTACTGCAG
GTGTCTTAGGTCTAGATGGATACCCTCTTCAGGTTGGTTAGCCTCCACCACCATCACCAC
CACCAGCACGCGGCCTCACCGTCGCCGCCGGACCAGCCGCACAAGTCGTACCCCTCCTCG
CGAGGGAGCACCAGCTCCCCCTCCTCCCACCACACCCACAACCACACCTACTACCACCAC
TCCCACTCCCACTACAACAATAATAGCAACACCAACTACTATTACCAGGGTGGTGGAGGC
GGCGGCGGAGGGTACTACTACGCGGAGGAGCAGCAGCCGGCGGCGTACCTAGAAGAATGC
GGCAACGGCCACCAGTTTTACATGGATGAAGACTTCTCCTCCTCGTCTTCCTCCCGCCAG
TTCCACTCGGGAACGGGCGCGCCGTCGTCGGCGCCGGTGCCTCCTCCTCCGTCGGCGACG
ACGTCGTCCGCGGGCGGGCACGGGCTGTTTGAGGCGGCGGACTTCTCGTTCCCGCAGGTT
GATATCAGCCTCGACTTCGGCGGCTCTCCGGCCGTTCCGTCGTCGTCCGGTGCTGGCGCC
GGCGCCGGGGCAGCGCCGTCGTCGTCGGGGAGGTGGGCGGCGCAGCTGCTGATGGAGTGC
GCGCGCGCGGTGGCGGGGCGCGACAGCCAGCGCGTGCAGCAGCTCATGTGGATGCTCAAC
GAGCTGGCCTCGCCGTACGGCGACGTCGACCAGAAGCTGGCCTCCTACTTCCTGCAGGGC
CTCTTCGCGCGGCTCACCACCTCCGGCCCGCGCACGCTGCGGACGCTCGCCACCGCGTCG
GACCGGAACGCGTCGTTCGACTCCACGCGCCGCACGGCGCTCAAGTTCCAGGAGCTCAGC
CCGTGGACGCCGTTCGGGCACGTCGCCGCCAACGGCGCCATACTCGAGTCGTTCCTGGAG
GCCGCGGCGGCGGGCGCCGCCGCCTCCTCCTCCTCGTCGTCTTCATCGTCGACGCCGCCG
ACGCGGCTGCACATCCTCGACCTGAGCAACACGTTCTGCACGCAGTGGCCGACCCTCCTG
GAGGCGCTGGCCACCCGGTCCTCGGACGACACGCCGCACCTGTCCATCACCACCGTCGTG
CCCACGGCGGCGCCGTCGGCGGCCGCGCAGCGCGTGATGCGGGAGATCGGGCAGCGCCTC
GAGAAGTTCGCGCGGCTGATGGGCGTCCCGTTCAGCTTCCGCGCCGTGCACCACTCGGGG
GACCTGGCCGACCTCGACCTCGCCGCGCTGGACCTCCGCGAGGGCGGCGCCACCGCCGCG
CTCGCCGTCAACTGCGTAAACGCGCTGCGCGGGGTCGCGCGGGGGCGCGACGCGTTCGTG
GCGTCGCTCCGGCGCCTGGAGCCGCGCGTGGTCACCGTCGTGGAGGAGGAGGCCGACCTG
GCGGCGCCGGAGGCGGACGCGTCGTCGGAGGCCGACACCGACGCCGCGTTCGTCAAGGTG
TTCGGCGAGGGCCTCCGCTTCTTCTCGGCGTACATGGACTCGCTGGAGGAGAGCTTCCCC
AAGACAAGCAACGAGAGGCTGTCACTGGAGAGGGCGGTCGGCCGTGCCATCGTCGACCTC
GTGTCATGCCCGGCCTCCCAGTCCGCCGAGCGCCGGGAGACCGCCGCGTCGTGGGCGCGG
CGCATGCGGTCGGCGGGGTTCTCGCCGGCGGCATTCAGCGAGGACGTCGCCGACGACGTG
CGGTCGCTTCTCCGGCGGTACAAGGAGGGCTGGTCGATGCGGGACGCCGGCGGTGCCACG
GACGACGCCGCCGGCGCCGCTGCTGCCGGAGCGTTCCTTGCGTGGAAGGAGCAGCCTGTC
GTGTGGGCGAGCGCGTGGAAGCCATGAGATCGATCGATCCAACAAGTCCAAATCCGCCAT
TGCTGCAAATCATCGAGCCTGCGATGCATCGTGCATGCAATACACAATATGGATCATGCA
TATCGCACGTGCGGGTTGAATGGGAAGAGGAAGCAGCGCGCGCGTGTACGTACTTAGGGT
TTTTCAGCCAGCAACGTACGTGTGTAGTAGGGAGAGGAGGTAGCAAAACACATCAGATGG
ATTAAGTTAATCAATCACCAGTTATTACTAGAAAATTAATTTGGAGGAATTAATTGGCAT
TTATTGTTCTTGCATTACATGTTTATTAATTATTAGATGCTTCCTCTGATTATTAACTTT
GTGAATTCAGGTGTGTTCAATTTAATTTTAGCTAGCTAGTAGATATATCGATCCTCAGGT
GATTTATTTGTAGATCTGAATATTCCATGACTTGTATAGGAGCTACTAATAGTTTATTTG
TTTTACCGGTTAACA

CDS

1812 bp

>Os03t0433200-01 SHR transcription factor, Regulation of the number of cortex cell layers in the root, Coordination of stomatal patterning
ATGGATACCCTCTTCAGGTTGGTTAGCCTCCACCACCATCACCACCACCAGCACGCGGCC
TCACCGTCGCCGCCGGACCAGCCGCACAAGTCGTACCCCTCCTCGCGAGGGAGCACCAGC
TCCCCCTCCTCCCACCACACCCACAACCACACCTACTACCACCACTCCCACTCCCACTAC
AACAATAATAGCAACACCAACTACTATTACCAGGGTGGTGGAGGCGGCGGCGGAGGGTAC
TACTACGCGGAGGAGCAGCAGCCGGCGGCGTACCTAGAAGAATGCGGCAACGGCCACCAG
TTTTACATGGATGAAGACTTCTCCTCCTCGTCTTCCTCCCGCCAGTTCCACTCGGGAACG
GGCGCGCCGTCGTCGGCGCCGGTGCCTCCTCCTCCGTCGGCGACGACGTCGTCCGCGGGC
GGGCACGGGCTGTTTGAGGCGGCGGACTTCTCGTTCCCGCAGGTTGATATCAGCCTCGAC
TTCGGCGGCTCTCCGGCCGTTCCGTCGTCGTCCGGTGCTGGCGCCGGCGCCGGGGCAGCG
CCGTCGTCGTCGGGGAGGTGGGCGGCGCAGCTGCTGATGGAGTGCGCGCGCGCGGTGGCG
GGGCGCGACAGCCAGCGCGTGCAGCAGCTCATGTGGATGCTCAACGAGCTGGCCTCGCCG
TACGGCGACGTCGACCAGAAGCTGGCCTCCTACTTCCTGCAGGGCCTCTTCGCGCGGCTC
ACCACCTCCGGCCCGCGCACGCTGCGGACGCTCGCCACCGCGTCGGACCGGAACGCGTCG
TTCGACTCCACGCGCCGCACGGCGCTCAAGTTCCAGGAGCTCAGCCCGTGGACGCCGTTC
GGGCACGTCGCCGCCAACGGCGCCATACTCGAGTCGTTCCTGGAGGCCGCGGCGGCGGGC
GCCGCCGCCTCCTCCTCCTCGTCGTCTTCATCGTCGACGCCGCCGACGCGGCTGCACATC
CTCGACCTGAGCAACACGTTCTGCACGCAGTGGCCGACCCTCCTGGAGGCGCTGGCCACC
CGGTCCTCGGACGACACGCCGCACCTGTCCATCACCACCGTCGTGCCCACGGCGGCGCCG
TCGGCGGCCGCGCAGCGCGTGATGCGGGAGATCGGGCAGCGCCTCGAGAAGTTCGCGCGG
CTGATGGGCGTCCCGTTCAGCTTCCGCGCCGTGCACCACTCGGGGGACCTGGCCGACCTC
GACCTCGCCGCGCTGGACCTCCGCGAGGGCGGCGCCACCGCCGCGCTCGCCGTCAACTGC
GTAAACGCGCTGCGCGGGGTCGCGCGGGGGCGCGACGCGTTCGTGGCGTCGCTCCGGCGC
CTGGAGCCGCGCGTGGTCACCGTCGTGGAGGAGGAGGCCGACCTGGCGGCGCCGGAGGCG
GACGCGTCGTCGGAGGCCGACACCGACGCCGCGTTCGTCAAGGTGTTCGGCGAGGGCCTC
CGCTTCTTCTCGGCGTACATGGACTCGCTGGAGGAGAGCTTCCCCAAGACAAGCAACGAG
AGGCTGTCACTGGAGAGGGCGGTCGGCCGTGCCATCGTCGACCTCGTGTCATGCCCGGCC
TCCCAGTCCGCCGAGCGCCGGGAGACCGCCGCGTCGTGGGCGCGGCGCATGCGGTCGGCG
GGGTTCTCGCCGGCGGCATTCAGCGAGGACGTCGCCGACGACGTGCGGTCGCTTCTCCGG
CGGTACAAGGAGGGCTGGTCGATGCGGGACGCCGGCGGTGCCACGGACGACGCCGCCGGC
GCCGCTGCTGCCGGAGCGTTCCTTGCGTGGAAGGAGCAGCCTGTCGTGTGGGCGAGCGCG
TGGAAGCCATGA

Protein

604 aa

>Os03t0433200-01 SHR transcription factor, Regulation of the number of cortex cell layers in the root, Coordination of stomatal patterning
MDTLFRLVSLHHHHHHQHAASPSPPDQPHKSYPSSRGSTSSPSSHHTHNHTYYHHSHSHY
NNNSNTNYYYQGGGGGGGGYYYAEEQQPAAYLEECGNGHQFYMDEDFSSSSSSRQFHSGT
GAPSSAPVPPPPSATTSSAGGHGLFEAADFSFPQVDISLDFGGSPAVPSSSGAGAGAGAA
PSSSGRWAAQLLMECARAVAGRDSQRVQQLMWMLNELASPYGDVDQKLASYFLQGLFARL
TTSGPRTLRTLATASDRNASFDSTRRTALKFQELSPWTPFGHVAANGAILESFLEAAAAG
AAASSSSSSSSSTPPTRLHILDLSNTFCTQWPTLLEALATRSSDDTPHLSITTVVPTAAP
SAAAQRVMREIGQRLEKFARLMGVPFSFRAVHHSGDLADLDLAALDLREGGATAALAVNC
VNALRGVARGRDAFVASLRRLEPRVVTVVEEEADLAAPEADASSEADTDAAFVKVFGEGL
RFFSAYMDSLEESFPKTSNERLSLERAVGRAIVDLVSCPASQSAERRETAASWARRMRSA
GFSPAAFSEDVADDVRSLLRRYKEGWSMRDAGGATDDAAGAAAAGAFLAWKEQPVVWASA
WKP*

5'UTR

chr03:18240536..18240730 (- strand) : 195 bp

CDS

chr03:18238724..18240535 (- strand) : 1812 bp

3'UTR

chr03:18238256..18238723 (- strand) : 468 bp

FASTA

>Os03t0433200-01 class=Sequence position=chr03:18238256..18240730 (- strand)
CACAACTAGC TAGTTTAGAT CCCCTTTGCA TCCATCGATG ATCAGTTGTT GCAGGACAGT GTAGTGAGGT GAGAAAGATT
GTTGTAGTAG CTGCTGTGCT GTATGGTGGT AGCCAGTGAG TAGCTACTAC ACTGCACTGC AGTTTGCACC CCGGCCATAT
GTTGGCTACT ACTACTGCAG GTGTCTTAGG TCTAGATGGA TACCCTCTTC AGGTTGGTTA GCCTCCACCA CCATCACCAC
CACCAGCACG CGGCCTCACC GTCGCCGCCG GACCAGCCGC ACAAGTCGTA CCCCTCCTCG CGAGGGAGCA CCAGCTCCCC
CTCCTCCCAC CACACCCACA ACCACACCTA CTACCACCAC TCCCACTCCC ACTACAACAA TAATAGCAAC ACCAACTACT
ATTACCAGGG TGGTGGAGGC GGCGGCGGAG GGTACTACTA CGCGGAGGAG CAGCAGCCGG CGGCGTACCT AGAAGAATGC
GGCAACGGCC ACCAGTTTTA CATGGATGAA GACTTCTCCT CCTCGTCTTC CTCCCGCCAG TTCCACTCGG GAACGGGCGC
GCCGTCGTCG GCGCCGGTGC CTCCTCCTCC GTCGGCGACG ACGTCGTCCG CGGGCGGGCA CGGGCTGTTT GAGGCGGCGG
ACTTCTCGTT CCCGCAGGTT GATATCAGCC TCGACTTCGG CGGCTCTCCG GCCGTTCCGT CGTCGTCCGG TGCTGGCGCC
GGCGCCGGGG CAGCGCCGTC GTCGTCGGGG AGGTGGGCGG CGCAGCTGCT GATGGAGTGC GCGCGCGCGG TGGCGGGGCG
CGACAGCCAG CGCGTGCAGC AGCTCATGTG GATGCTCAAC GAGCTGGCCT CGCCGTACGG CGACGTCGAC CAGAAGCTGG
CCTCCTACTT CCTGCAGGGC CTCTTCGCGC GGCTCACCAC CTCCGGCCCG CGCACGCTGC GGACGCTCGC CACCGCGTCG
GACCGGAACG CGTCGTTCGA CTCCACGCGC CGCACGGCGC TCAAGTTCCA GGAGCTCAGC CCGTGGACGC CGTTCGGGCA
CGTCGCCGCC AACGGCGCCA TACTCGAGTC GTTCCTGGAG GCCGCGGCGG CGGGCGCCGC CGCCTCCTCC TCCTCGTCGT
CTTCATCGTC GACGCCGCCG ACGCGGCTGC ACATCCTCGA CCTGAGCAAC ACGTTCTGCA CGCAGTGGCC GACCCTCCTG
GAGGCGCTGG CCACCCGGTC CTCGGACGAC ACGCCGCACC TGTCCATCAC CACCGTCGTG CCCACGGCGG CGCCGTCGGC
GGCCGCGCAG CGCGTGATGC GGGAGATCGG GCAGCGCCTC GAGAAGTTCG CGCGGCTGAT GGGCGTCCCG TTCAGCTTCC
GCGCCGTGCA CCACTCGGGG GACCTGGCCG ACCTCGACCT CGCCGCGCTG GACCTCCGCG AGGGCGGCGC CACCGCCGCG
CTCGCCGTCA ACTGCGTAAA CGCGCTGCGC GGGGTCGCGC GGGGGCGCGA CGCGTTCGTG GCGTCGCTCC GGCGCCTGGA
GCCGCGCGTG GTCACCGTCG TGGAGGAGGA GGCCGACCTG GCGGCGCCGG AGGCGGACGC GTCGTCGGAG GCCGACACCG
ACGCCGCGTT CGTCAAGGTG TTCGGCGAGG GCCTCCGCTT CTTCTCGGCG TACATGGACT CGCTGGAGGA GAGCTTCCCC
AAGACAAGCA ACGAGAGGCT GTCACTGGAG AGGGCGGTCG GCCGTGCCAT CGTCGACCTC GTGTCATGCC CGGCCTCCCA
GTCCGCCGAG CGCCGGGAGA CCGCCGCGTC GTGGGCGCGG CGCATGCGGT CGGCGGGGTT CTCGCCGGCG GCATTCAGCG
AGGACGTCGC CGACGACGTG CGGTCGCTTC TCCGGCGGTA CAAGGAGGGC TGGTCGATGC GGGACGCCGG CGGTGCCACG
GACGACGCCG CCGGCGCCGC TGCTGCCGGA GCGTTCCTTG CGTGGAAGGA GCAGCCTGTC GTGTGGGCGA GCGCGTGGAA
GCCATGAGAT CGATCGATCC AACAAGTCCA AATCCGCCAT TGCTGCAAAT CATCGAGCCT GCGATGCATC GTGCATGCAA
TACACAATAT GGATCATGCA TATCGCACGT GCGGGTTGAA TGGGAAGAGG AAGCAGCGCG CGCGTGTACG TACTTAGGGT
TTTTCAGCCA GCAACGTACG TGTGTAGTAG GGAGAGGAGG TAGCAAAACA CATCAGATGG ATTAAGTTAA TCAATCACCA
GTTATTACTA GAAAATTAAT TTGGAGGAAT TAATTGGCAT TTATTGTTCT TGCATTACAT GTTTATTAAT TATTAGATGC
TTCCTCTGAT TATTAACTTT GTGAATTCAG GTGTGTTCAA TTTAATTTTA GCTAGCTAGT AGATATATCG ATCCTCAGGT
GATTTATTTG TAGATCTGAA TATTCCATGA CTTGTATAGG AGCTACTAAT AGTTTATTTG TTTTACCGGT TAACA

Locus: Os03g0433200

Loading...

Locus: Os03g0433200

Loading...