Os03t0445700-01

Locus

Os03g0445700

Description

LATERAL ORGAN BOUNDARIES DOMAIN (LBD) protein, Transcriptional activator, Regulation of heading date and yield

RAP-DB Gene Symbol Synonym(s)

OsLBD37

RAP-DB Gene Name Synonym(s)

LATERAL ORGAN BOUNDARIES DOMAIN 37

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLBD37, LBD37

Oryzabase Gene Name Synonym(s)

LATERAL ORGAN BOUNDARIES DOMAIN 37, lateral organ boundaries domain protein 37

Transcript Evidence

AK071624

Protein Evidence

Q6AV61

Literature

PMID: 28342864

Note

Manual Curation

October 26, 2017

Functional domain (InterPro)

Lateral organ boundaries, LOB (IPR004883)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023106M18 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0445700-01)

RiceXPro (AK071624)

Others

Oryzabase (21732)

KEGG (Os03t0445700-01)

Transcript

1011 bp

>Os03t0445700-01 LATERAL ORGAN BOUNDARIES DOMAIN (LBD) protein, Transcriptional activator, Regulation of heading date and yield
GTTCCCTCCCCCTCGCTCTCCCTGCTCCGGTATAGCTAGTTGAGCTCTGATCGATCAGGT
TGCATGAGACGGAGAAGCTGAGTGAGGCTAGGGTGGTTGGTTGTGATCATCACCATGAGC
TGCAACGGTTGCCGGGTGCTGCGGAAGGGGTGCAGTGACGGCTGCGTGCTGCGGCCATGC
CTGCAGTGGATCGACGCCGCCGACGCGCAGGGCCACGCCACCGTCTTCGTCGCCAAGTTC
TTCGGCCGCGCCGGACTCCTCTCCTTCATCTCCGCTGTCCCCGAGGCGCAGCGACCTGCG
TTGTTCCAGTCGCTGCTGTACGAAGCAGCGGGGCGAACCATCAATCCGGTGCACGGCGCG
GTGGGCCTCCTCTGGACGGGGAACTGGCCCCTCTGCCAGGCCGCTGTCGAGACCGTGCTG
CGTGGAGGCGCCATCGGCCCTCTGCCGGAGCTCGGCGGGGCCTGCGGCGGCGCTGGCGGG
GACCTCTACGGCGCCGCCAAGCGCAACGGCGGCTGGTCTACCTTCTCCACTGCGAAGCGG
GTGAGGAAGGCCGAGGTACCTGAAGCCCCGTCGTGCGACCTAGGCCTGTGCCTCAGCCCC
GGCTCTCCGCCGGCGGTGGGGGAGAGGAAACCAGCACTGCGGCCGGGGACGCCGTCAATG
AGCTCCGATGAGTCCGGCACCACAACCGGAGGCGAAAGGGATCCTGTGCTGCTCAACCTT
TTTGTCTGAGGCCGGTCGTCAAGCTAGCTAATACTAATCCTTGCTTGACCTCCGTCTACT
GGATCCCGGCGGCGAAGCAGTAGTAATTTTTTCTCGCCGGCGAGCCTAGTTTATTGGCAT
TTTTTTTTCTTTCCCTTTCTTTTAGGAGTACTAGTCTACGAGTCTTGGTTTTTGCCGTGT
ACGTAGAAAAGAAATTACCGGCCGGCCTGGACGCCCCGTTTGCGTGGGCGAGCAACTTTT
TACCCTTTTTGTTCGTTTAAATTATATAAATAATCCTTCATTAAGCTATAT

CDS

615 bp

>Os03t0445700-01 LATERAL ORGAN BOUNDARIES DOMAIN (LBD) protein, Transcriptional activator, Regulation of heading date and yield
ATGAGCTGCAACGGTTGCCGGGTGCTGCGGAAGGGGTGCAGTGACGGCTGCGTGCTGCGG
CCATGCCTGCAGTGGATCGACGCCGCCGACGCGCAGGGCCACGCCACCGTCTTCGTCGCC
AAGTTCTTCGGCCGCGCCGGACTCCTCTCCTTCATCTCCGCTGTCCCCGAGGCGCAGCGA
CCTGCGTTGTTCCAGTCGCTGCTGTACGAAGCAGCGGGGCGAACCATCAATCCGGTGCAC
GGCGCGGTGGGCCTCCTCTGGACGGGGAACTGGCCCCTCTGCCAGGCCGCTGTCGAGACC
GTGCTGCGTGGAGGCGCCATCGGCCCTCTGCCGGAGCTCGGCGGGGCCTGCGGCGGCGCT
GGCGGGGACCTCTACGGCGCCGCCAAGCGCAACGGCGGCTGGTCTACCTTCTCCACTGCG
AAGCGGGTGAGGAAGGCCGAGGTACCTGAAGCCCCGTCGTGCGACCTAGGCCTGTGCCTC
AGCCCCGGCTCTCCGCCGGCGGTGGGGGAGAGGAAACCAGCACTGCGGCCGGGGACGCCG
TCAATGAGCTCCGATGAGTCCGGCACCACAACCGGAGGCGAAAGGGATCCTGTGCTGCTC
AACCTTTTTGTCTGA

Protein

205 aa

>Os03t0445700-01 LATERAL ORGAN BOUNDARIES DOMAIN (LBD) protein, Transcriptional activator, Regulation of heading date and yield
MSCNGCRVLRKGCSDGCVLRPCLQWIDAADAQGHATVFVAKFFGRAGLLSFISAVPEAQR
PALFQSLLYEAAGRTINPVHGAVGLLWTGNWPLCQAAVETVLRGGAIGPLPELGGACGGA
GGDLYGAAKRNGGWSTFSTAKRVRKAEVPEAPSCDLGLCLSPGSPPAVGERKPALRPGTP
SMSSDESGTTTGGERDPVLLNLFV*

5'UTR

chr03:18936182..18936295 (- strand) : 114 bp

CDS

chr03:18935998..18936181 (- strand) : 184 bp

chr03:18935476..18935906 (- strand) : 431 bp

3'UTR

chr03:18935194..18935475 (- strand) : 282 bp

FASTA

>Os03t0445700-01 class=Sequence position=chr03:18935194..18936295 (- strand)
GTTCCCTCCC CCTCGCTCTC CCTGCTCCGG TATAGCTAGT TGAGCTCTGA TCGATCAGGT TGCATGAGAC GGAGAAGCTG
AGTGAGGCTA GGGTGGTTGG TTGTGATCAT CACCATGAGC TGCAACGGTT GCCGGGTGCT GCGGAAGGGG TGCAGTGACG
GCTGCGTGCT GCGGCCATGC CTGCAGTGGA TCGACGCCGC CGACGCGCAG GGCCACGCCA CCGTCTTCGT CGCCAAGTTC
TTCGGCCGCG CCGGACTCCT CTCCTTCATC TCCGCTGTCC CCGAGGCGCA GCGACCTGGT ATGTAGAATA CAATCCATCA
CGGCTCTGCA CGTGTACCGT ACATATTCCT GTACGAAGCA GCTGACCATA TGTCGTTGGT TGCGCGCAGC GTTGTTCCAG
TCGCTGCTGT ACGAAGCAGC GGGGCGAACC ATCAATCCGG TGCACGGCGC GGTGGGCCTC CTCTGGACGG GGAACTGGCC
CCTCTGCCAG GCCGCTGTCG AGACCGTGCT GCGTGGAGGC GCCATCGGCC CTCTGCCGGA GCTCGGCGGG GCCTGCGGCG
GCGCTGGCGG GGACCTCTAC GGCGCCGCCA AGCGCAACGG CGGCTGGTCT ACCTTCTCCA CTGCGAAGCG GGTGAGGAAG
GCCGAGGTAC CTGAAGCCCC GTCGTGCGAC CTAGGCCTGT GCCTCAGCCC CGGCTCTCCG CCGGCGGTGG GGGAGAGGAA
ACCAGCACTG CGGCCGGGGA CGCCGTCAAT GAGCTCCGAT GAGTCCGGCA CCACAACCGG AGGCGAAAGG GATCCTGTGC
TGCTCAACCT TTTTGTCTGA GGCCGGTCGT CAAGCTAGCT AATACTAATC CTTGCTTGAC CTCCGTCTAC TGGATCCCGG
CGGCGAAGCA GTAGTAATTT TTTCTCGCCG GCGAGCCTAG TTTATTGGCA TTTTTTTTTC TTTCCCTTTC TTTTAGGAGT
ACTAGTCTAC GAGTCTTGGT TTTTGCCGTG TACGTAGAAA AGAAATTACC GGCCGGCCTG GACGCCCCGT TTGCGTGGGC
GAGCAACTTT TTACCCTTTT TGTTCGTTTA AATTATATAA ATAATCCTTC ATTAAGCTAT AT

Locus: Os03g0445700

Loading...

Locus: Os03g0445700

Loading...