Os03t0575200-01

Locus

Os03g0575200

Description

High-affinity potassium transporter, Maintenance of potassium homeostasis, Salt tolerance

RAP-DB Gene Symbol Synonym(s)

OsHAK16

RAP-DB Gene Name Synonym(s)

High-affinity Potassium(K+) Transporter 16

CGSNL Gene Symbol

HAK16

CGSNL Gene Name

HIGH-AFFINITY POTASSIUM(K+) TRANSPORTER 16

Oryzabase Gene Symbol Synonym(s)

OsHAK16

Oryzabase Gene Name Synonym(s)

High-affinity Potassium(K+) Transporter 16, Probable potassium transporter 16

Transcript Evidence

AK066919

Protein Evidence

Q84MS3

Literature

PMID: 31119363

Note

Manual Curation

May 27, 2019

Gene Ontology (GO)

Biological Process: potassium ion transmembrane transport (GO:0071805)

Molecular Function: potassium ion transmembrane transporter activity (GO:0015079)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Potassium transporter (IPR003855)

Full-length cDNA

J013089M07 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0575200-01)

RiceXPro (AK066919)

Others

Oryzabase (8670)

KEGG (Os03t0575200-01)

Transcript

2904 bp

>Os03t0575200-01 High-affinity potassium transporter, Maintenance of potassium homeostasis, Salt tolerance
GAGCTTAGCTGCTGCGAAGTTACACGGCTACGCACCGTTCTTGCTAACTATATACGATTT
CTTATACACTTATTTCTTTTGAGGCATAGCGTGCTGGCTAAGTATAGGTAGGTAGCTAGC
TCTGCCGCTGCTTATAAAAAGGCAGTGCTGCACGGTGGTGAGCGTACCTAGCTAGAGCAT
AGAGAAGCAGGAAAGTTTTGGAGATCGATCGATGGCACAGCAGCAAGCCGGTGCAAGAGG
CAGCAAGCTGGAGATCGTCGCCGCCCGGGGAGGAAGTGGCGGCAGCAGCAGCGCCGGCGA
TGCGGAGGCGCCGCCGTTGGACGTCCTGAGGCAGGACTCCCTCTACCGCGACGCGACGCG
GCCGGCCCACGGCCACCATGGACAGGAGAGCTGGATGAGGACGCTGCGGCTGGGGTTCCA
GTGCGTGGGAATCCTGCACGCCGACCTCGGCACGTCGCCGCTCTACGTGTACCAGAACAC
ATTCAAGTACGGCATCAAGCACGAGGACGACATCATCGGCGTCCTCTCCCTCATCATCTA
CAGCTTCGTGCTATTCACCATGGTCAAGATCGTCTTCATCGCCCTCCACGCCAACGACGA
TGGCGACGGTGGGACATTTGCTCTGTACTCGTTGATCTCGCGGTACGCCAAGGTGTGCCT
GATCCCAAACCAGCAAGCCGAGGATGAGCTGGTGACGAGGTACAACGACCACGGGAAGCC
GCCGGCGACGCTGCGGAGGGCGCAGTGGATGAAGAGCCAGCTCGAGAAGAAGCCCGCCAA
GATTGCCGTCTTCTTCCTCACCATCTTCGCCACCGCGCTGGCCATCAGCGACTGTGTGCT
AAACCCTTCAGTCTCTGTACTTTCGGCGGTCAACGGCTTGAAACTTAGAGCACCTCATCT
GACAACAGACGAAGTGGTCTGGATCACGGTGGGAATACTGGTGGTGTTTTTCGCAGTGCA
ACGGTTTGGCACTGACAAGATTGGCTACACATTTGCCCCGGTTGTTGTTGTGTGGCTGTT
ACTCATCTCAGGGATTGGCATCTATGACTTGGTCAAGTACGATGTCGGTGTCTTGAGGGC
GTTCAACCCCAAATATATCATCGATTATTTCCGACGAAATAAGAAGGACGGATGGGTCCA
GCTCGGTGAAGTTCTTCTTACATTTACCGGCACAGAAGCTCTCTTTGCTGATTTAGGATA
CTTCAGCATCAAATCAATTCAGTTAAGCTCTACCTTTGTCTTGCTCCCATCAGTGTTATG
CACCTACATTGGGCAAGCAGCATACCTAAGGAAACACATGGATCAGCAGCACATACAAAA
CGCTTTCTTCAATTCCATTCCAAGACCTCTGTTCTGGCCAATGTTCGTTCTCGCTATCAT
GACGTCAGTCATCGGTTGCCAAGCCATGGTGTCTTGTGCCTTTGCAACCATGTCACACTT
GCAGACACTGAATTGTTTCCCACGGATTAAGATACTGCACACATCAAGGCGTTATTCAGG
ACAGTTGTACAGTCCTGAAGTGAACTTCTTCCTCTGCCTACTTTCCTGTGTAATCACCTT
AAGTTTCAGGACGACAGGTTTCATTGTCAAAGCACATGAAATTTGTGTGGTCCTTGTGAT
GGTTATCACAACTATCCTGATGACTATAGTCATGCTTCTCGTATGGAAAGTAAATATTTG
GTGGATCGTTCTATTCTTTGTCGTCTTCATGTCAACGGAGACCGTCTACCTATCAGCAGT
TCTCTACAAGTTCACAAAAGGACCATACATGCCCTTGGCTATGTCAGCTGTTCTAATGGT
GATCATGTTCGTGTGGCACTACGTGCATGTGAAGCGATACAAGTTTGAGCTTGAACATAC
CGTATCACCTAATAAGGTCAGAGAGCTCCTTGAACGGCGTGATCTAAAGAGGGTTCCTGG
TGTGGGGCTCTTCTACACTGAATTGGTGCAAGGCATCCCACCGATATTCCCTCACCTTAT
CGAGAAAATCCCGACCATTCACTCGGTGATCGTGTTCATCTCTATGAAGCACTTGCCTAT
CCCTCATGTCGATGTCTCGGAGCGCTTCCTCTTCCGGCAAGTGGAGCCCAAGGAGTGCAT
GGTGTTTCGATGTGTCGCACGATATGGATATCGGGATACTCTAGAGATGGCTGATGACTT
TGTCACCACTCTTGTCGAGTACCTCCAGTACTATATCCGGGACCTAAATCTATACAACAC
GGTTGAGCCACTCAAGATGAGCTGCCCAAGCATTAGAATTGATAGTTTTTCCTGGGATAG
ACGACCCTCAGGGCATGGCATTTATGCCGAGGAGATGCTTACACCAATCCAATCATTTTC
TGAGCTCACAATGCATCCTGTTGGTATGAGCAGCCGATTAGCGCAATTCCAAACAACTAA
GATGAGCCTTGAAGAGATGTTGAAGATTGAGGAAGACCAAAAGTTGATCCAACGAGAAGT
GGACAATGGTGTGGTTTACATACTTGGGGAGAGTGAAGTGGTAGCGAAACCACATTCCAA
CTTGCTTAAGAAAGTTGTTGTAAACTACATATTCAACTTTCTGAGGAAAAACTCTCGAAA
AGGAGAGAAGATGTTGTCTATTCCACGCCGCAAGTTGCTCAAGGTTGGAATCACGTACGA
AATATAAACATGCCAACAATCAGTAAGATGGTGGCTTATACACAAGGGGTGTAGATTTGT
CGAGCAAGCATATATCATGCATGCAGGGTTTGCTTACTTGCAAATGTACTTGGATTTTGT
TTGCTTGCGTGACTCTCCATGATAGGAAAAAAAATAAAAGAATTACATGCAAGGAGGAAA
ATATGCCAGCAAAATGAAAACAGTCATAATCGAGAATATCACAATGCGATATATGGGTTC
CATATATATAGAATTTCTTTTTTC

CDS

2436 bp

>Os03t0575200-01 High-affinity potassium transporter, Maintenance of potassium homeostasis, Salt tolerance
ATGGCACAGCAGCAAGCCGGTGCAAGAGGCAGCAAGCTGGAGATCGTCGCCGCCCGGGGA
GGAAGTGGCGGCAGCAGCAGCGCCGGCGATGCGGAGGCGCCGCCGTTGGACGTCCTGAGG
CAGGACTCCCTCTACCGCGACGCGACGCGGCCGGCCCACGGCCACCATGGACAGGAGAGC
TGGATGAGGACGCTGCGGCTGGGGTTCCAGTGCGTGGGAATCCTGCACGCCGACCTCGGC
ACGTCGCCGCTCTACGTGTACCAGAACACATTCAAGTACGGCATCAAGCACGAGGACGAC
ATCATCGGCGTCCTCTCCCTCATCATCTACAGCTTCGTGCTATTCACCATGGTCAAGATC
GTCTTCATCGCCCTCCACGCCAACGACGATGGCGACGGTGGGACATTTGCTCTGTACTCG
TTGATCTCGCGGTACGCCAAGGTGTGCCTGATCCCAAACCAGCAAGCCGAGGATGAGCTG
GTGACGAGGTACAACGACCACGGGAAGCCGCCGGCGACGCTGCGGAGGGCGCAGTGGATG
AAGAGCCAGCTCGAGAAGAAGCCCGCCAAGATTGCCGTCTTCTTCCTCACCATCTTCGCC
ACCGCGCTGGCCATCAGCGACTGTGTGCTAAACCCTTCAGTCTCTGTACTTTCGGCGGTC
AACGGCTTGAAACTTAGAGCACCTCATCTGACAACAGACGAAGTGGTCTGGATCACGGTG
GGAATACTGGTGGTGTTTTTCGCAGTGCAACGGTTTGGCACTGACAAGATTGGCTACACA
TTTGCCCCGGTTGTTGTTGTGTGGCTGTTACTCATCTCAGGGATTGGCATCTATGACTTG
GTCAAGTACGATGTCGGTGTCTTGAGGGCGTTCAACCCCAAATATATCATCGATTATTTC
CGACGAAATAAGAAGGACGGATGGGTCCAGCTCGGTGAAGTTCTTCTTACATTTACCGGC
ACAGAAGCTCTCTTTGCTGATTTAGGATACTTCAGCATCAAATCAATTCAGTTAAGCTCT
ACCTTTGTCTTGCTCCCATCAGTGTTATGCACCTACATTGGGCAAGCAGCATACCTAAGG
AAACACATGGATCAGCAGCACATACAAAACGCTTTCTTCAATTCCATTCCAAGACCTCTG
TTCTGGCCAATGTTCGTTCTCGCTATCATGACGTCAGTCATCGGTTGCCAAGCCATGGTG
TCTTGTGCCTTTGCAACCATGTCACACTTGCAGACACTGAATTGTTTCCCACGGATTAAG
ATACTGCACACATCAAGGCGTTATTCAGGACAGTTGTACAGTCCTGAAGTGAACTTCTTC
CTCTGCCTACTTTCCTGTGTAATCACCTTAAGTTTCAGGACGACAGGTTTCATTGTCAAA
GCACATGAAATTTGTGTGGTCCTTGTGATGGTTATCACAACTATCCTGATGACTATAGTC
ATGCTTCTCGTATGGAAAGTAAATATTTGGTGGATCGTTCTATTCTTTGTCGTCTTCATG
TCAACGGAGACCGTCTACCTATCAGCAGTTCTCTACAAGTTCACAAAAGGACCATACATG
CCCTTGGCTATGTCAGCTGTTCTAATGGTGATCATGTTCGTGTGGCACTACGTGCATGTG
AAGCGATACAAGTTTGAGCTTGAACATACCGTATCACCTAATAAGGTCAGAGAGCTCCTT
GAACGGCGTGATCTAAAGAGGGTTCCTGGTGTGGGGCTCTTCTACACTGAATTGGTGCAA
GGCATCCCACCGATATTCCCTCACCTTATCGAGAAAATCCCGACCATTCACTCGGTGATC
GTGTTCATCTCTATGAAGCACTTGCCTATCCCTCATGTCGATGTCTCGGAGCGCTTCCTC
TTCCGGCAAGTGGAGCCCAAGGAGTGCATGGTGTTTCGATGTGTCGCACGATATGGATAT
CGGGATACTCTAGAGATGGCTGATGACTTTGTCACCACTCTTGTCGAGTACCTCCAGTAC
TATATCCGGGACCTAAATCTATACAACACGGTTGAGCCACTCAAGATGAGCTGCCCAAGC
ATTAGAATTGATAGTTTTTCCTGGGATAGACGACCCTCAGGGCATGGCATTTATGCCGAG
GAGATGCTTACACCAATCCAATCATTTTCTGAGCTCACAATGCATCCTGTTGGTATGAGC
AGCCGATTAGCGCAATTCCAAACAACTAAGATGAGCCTTGAAGAGATGTTGAAGATTGAG
GAAGACCAAAAGTTGATCCAACGAGAAGTGGACAATGGTGTGGTTTACATACTTGGGGAG
AGTGAAGTGGTAGCGAAACCACATTCCAACTTGCTTAAGAAAGTTGTTGTAAACTACATA
TTCAACTTTCTGAGGAAAAACTCTCGAAAAGGAGAGAAGATGTTGTCTATTCCACGCCGC
AAGTTGCTCAAGGTTGGAATCACGTACGAAATATAA

Protein

812 aa

>Os03t0575200-01 High-affinity potassium transporter, Maintenance of potassium homeostasis, Salt tolerance
MAQQQAGARGSKLEIVAARGGSGGSSSAGDAEAPPLDVLRQDSLYRDATRPAHGHHGQES
WMRTLRLGFQCVGILHADLGTSPLYVYQNTFKYGIKHEDDIIGVLSLIIYSFVLFTMVKI
VFIALHANDDGDGGTFALYSLISRYAKVCLIPNQQAEDELVTRYNDHGKPPATLRRAQWM
KSQLEKKPAKIAVFFLTIFATALAISDCVLNPSVSVLSAVNGLKLRAPHLTTDEVVWITV
GILVVFFAVQRFGTDKIGYTFAPVVVVWLLLISGIGIYDLVKYDVGVLRAFNPKYIIDYF
RRNKKDGWVQLGEVLLTFTGTEALFADLGYFSIKSIQLSSTFVLLPSVLCTYIGQAAYLR
KHMDQQHIQNAFFNSIPRPLFWPMFVLAIMTSVIGCQAMVSCAFATMSHLQTLNCFPRIK
ILHTSRRYSGQLYSPEVNFFLCLLSCVITLSFRTTGFIVKAHEICVVLVMVITTILMTIV
MLLVWKVNIWWIVLFFVVFMSTETVYLSAVLYKFTKGPYMPLAMSAVLMVIMFVWHYVHV
KRYKFELEHTVSPNKVRELLERRDLKRVPGVGLFYTELVQGIPPIFPHLIEKIPTIHSVI
VFISMKHLPIPHVDVSERFLFRQVEPKECMVFRCVARYGYRDTLEMADDFVTTLVEYLQY
YIRDLNLYNTVEPLKMSCPSIRIDSFSWDRRPSGHGIYAEEMLTPIQSFSELTMHPVGMS
SRLAQFQTTKMSLEEMLKIEEDQKLIQREVDNGVVYILGESEVVAKPHSNLLKKVVVNYI
FNFLRKNSRKGEKMLSIPRRKLLKVGITYEI*

5'UTR

chr03:21007419..21007629 (- strand) : 211 bp

CDS

chr03:21007245..21007418 (- strand) : 174 bp

chr03:21006765..21006987 (- strand) : 223 bp

chr03:21006408..21006656 (- strand) : 249 bp

chr03:21006242..21006292 (- strand) : 51 bp

chr03:21005487..21005747 (- strand) : 261 bp

chr03:21005224..21005276 (- strand) : 53 bp

chr03:21004651..21004771 (- strand) : 121 bp

chr03:21004296..21004550 (- strand) : 255 bp

chr03:21003415..21004208 (- strand) : 794 bp

chr03:21003054..21003308 (- strand) : 255 bp

3'UTR

chr03:21002797..21003053 (- strand) : 257 bp

FASTA

>Os03t0575200-01 class=Sequence position=chr03:21002797..21007629 (- strand)
GAGCTTAGCT GCTGCGAAGT TACACGGCTA CGCACCGTTC TTGCTAACTA TATACGATTT CTTATACACT TATTTCTTTT
GAGGCATAGC GTGCTGGCTA AGTATAGGTA GGTAGCTAGC TCTGCCGCTG CTTATAAAAA GGCAGTGCTG CACGGTGGTG
AGCGTACCTA GCTAGAGCAT AGAGAAGCAG GAAAGTTTTG GAGATCGATC GATGGCACAG CAGCAAGCCG GTGCAAGAGG
CAGCAAGCTG GAGATCGTCG CCGCCCGGGG AGGAAGTGGC GGCAGCAGCA GCGCCGGCGA TGCGGAGGCG CCGCCGTTGG
ACGTCCTGAG GCAGGACTCC CTCTACCGCG ACGCGACGCG GCCGGCCCAC GGCCACCATG GACAGGTGCT TGCTCATACT
AAGCTATTAT AAGTTATATG CATGCATGGC CATGGCCGAA AATTCAGCAA AAACATTTGT GGCACTAGCT TTCCTCTTGC
CATCCATGAA CATGGCGAAC GAATCTGCCG CAAGCAGAAA CTAAGTTGTA CTCCCTCCGT CTTATAAAAA ACTTAACTTA
GGGGGAACGA ATCTGGACAA TATTATCTAG TAGCACACAT AGTGTTGGCT AGGTAGGCTG AATGAGTGGT TGATATATGC
AGGAGAGCTG GATGAGGACG CTGCGGCTGG GGTTCCAGTG CGTGGGAATC CTGCACGCCG ACCTCGGCAC GTCGCCGCTC
TACGTGTACC AGAACACATT CAAGTACGGC ATCAAGCACG AGGACGACAT CATCGGCGTC CTCTCCCTCA TCATCTACAG
CTTCGTGCTA TTCACCATGG TCAAGATCGT CTTCATCGCC CTCCACGCCA ACGACGATGG CGACGGTGCG TGCAGTGTGC
CCGACGACGC TTCCCAATAC AAGTCTTCTT TGATCGATCA TCACTAGTTG TTTGTTTGTT CTTACTATCG ATTATAATTA
ATGGTTTTTT CAGGTGGGAC ATTTGCTCTG TACTCGTTGA TCTCGCGGTA CGCCAAGGTG TGCCTGATCC CAAACCAGCA
AGCCGAGGAT GAGCTGGTGA CGAGGTACAA CGACCACGGG AAGCCGCCGG CGACGCTGCG GAGGGCGCAG TGGATGAAGA
GCCAGCTCGA GAAGAAGCCC GCCAAGATTG CCGTCTTCTT CCTCACCATC TTCGCCACCG CGCTGGCCAT CAGCGACTGT
GTGCTAAACC CTTCAGTCTC TGGTACACTA TATAGCTAGA TTAATGCACA ATTATTGATT TACGCATAGT AATAATTGAT
ATAGTTAGTG TTCGATCGAC CTGACATGAT TTTGATCTTT TTGTTGTTTT GCTTCAGTAC TTTCGGCGGT CAACGGCTTG
AAACTTAGAG CACCTCATCT GACAACAGGT ACAGTGAGAA AACAGAAAGC AGTAGTAGTA TTACCCCCCG GAATTCAGTT
TAAAAAATGG CGAGTCTTTA AACGAACAGT GAACCAAATA ACGTGAAAAG CAAATTGTCG GTTAATCAAA TACTACATGG
CTACAGTGGT GCATGGACCA AAAGTCTAAT CCATATTATA CATTATTTTC GGTTTCACAC GTTGCATGTG ACAAAATTGC
ATGCAAACGC GATCAAGTCT AACATAATTA ATGCATAAGG ACTAGATCAC TCCTTGAACT GCACAACTAA TGTTTCCTGA
TCATCTTGTC AAGACTATTA ACTGTCCACA ATATTATAGG AGATCTCGAT TAAAAAACTG ATGCTACGGT TGATTAATTA
ATTTACTAGG TTGTGACCCA AATTGCAACG TGAACACTAT GGTATCATGA CAGAACTTGT ACTGATCAAC GCGCATATAG
ATTTACTAGT TAATTGCTGA TGAACTATTT TCATCTGAAC AGACGAAGTG GTCTGGATCA CGGTGGGAAT ACTGGTGGTG
TTTTTCGCAG TGCAACGGTT TGGCACTGAC AAGATTGGCT ACACATTTGC CCCGGTTGTT GTTGTGTGGC TGTTACTCAT
CTCAGGGATT GGCATCTATG ACTTGGTCAA GTACGATGTC GGTGTCTTGA GGGCGTTCAA CCCCAAATAT ATCATCGATT
ATTTCCGACG AAATAAGAAG GACGGATGGG TCCAGCTCGG TGAAGTTCTT CTTACATTTA CCGGTGAGCT TAATTAATTA
CATGTTGTAC TGAGTCTTGT GTGACAGAAA TGAACGAACA AACATTAATG TCATTAGGCA GATGATATTG CATTCACTCT
GTTCATTTTG TTAAGCATGA TGCAGTGACA GGACAGACAT GTGCATCTGC ATAATTGTGG ATAGTTGTAA ATAAGTTTAC
TTAATTGAAG CAATTTTGTC TTTTGAATAA CAGGCACAGA AGCTCTCTTT GCTGATTTAG GATACTTCAG CATCAAATCA
ATTCAGGTAG ACTGTTATTA CTTAACATCC CTTTGAATTA TTCAAGCTGA GGTCTGAAGA TATTTACTTT TTTCTAGGGT
AATGATAGAA GTGTCTCCAT ATATAATTTG AAAGTGATGC AAATATAATT CATTGATATT AATTATTTGA AGGCCCAGTT
AATTTCTTCC CTGTTATGTT GACTGGTCTG GAGTGAATAG GGTTGAAAGA TGAAATACAG CCAGTGGCTG TGTTGTGTTG
GTAAAGCACA CGTTAACATA GTACACCACC ATTAATTATG TGCCATTGCT TTGACGTGAT GGTCTCACCA AACAAAGGAT
AACTTACTAA TGCAACTTTT CAAGTGCTGG TGTTTTGCCA ATATTTATCC GATATAGGAG TACATATATA TAGGTAGTTG
TACATATATC ATATATAATT AAACATTTTG AAACTGATCA ATCTTTTCTA TGTTTCAGTT AAGCTCTACC TTTGTCTTGC
TCCCATCAGT GTTATGCACC TACATTGGGC AAGCAGCATA CCTAAGGAAA CACATGGATC AGCAGCACAT ACAAAACGCT
TTCTTCAATT CCATTCCAAG TATGTAAACC AAAACATACA TCACCTATCA TAAGCTTCGA AATTCATCGT CATCACGTAC
TGACAGAATA TACATGGCTC TTCCGATTGT AATTTACAGG ACCTCTGTTC TGGCCAATGT TCGTTCTCGC TATCATGACG
TCAGTCATCG GTTGCCAAGC CATGGTGTCT TGTGCCTTTG CAACCATGTC ACACTTGCAG ACACTGAATT GTTTCCCACG
GATTAAGATA CTGCACACAT CAAGGCGTTA TTCAGGACAG TTGTACAGTC CTGAAGTGAA CTTCTTCCTC TGCCTACTTT
CCTGTGTAAT CACCTTAAGT TTCAGGACGA CAGGTTTCAT TGTCAAAGCA CATGGTAAGG ACACTTCTAA ATGTGCAACC
TTATTTATTT TTTAATTTCA AATACTGATG ATACTGACTA TTCTTCTTCA TTGTCAAACA GAAATTTGTG TGGTCCTTGT
GATGGTTATC ACAACTATCC TGATGACTAT AGTCATGCTT CTCGTATGGA AAGTAAATAT TTGGTGGATC GTTCTATTCT
TTGTCGTCTT CATGTCAACG GAGACCGTCT ACCTATCAGC AGTTCTCTAC AAGTTCACAA AAGGACCATA CATGCCCTTG
GCTATGTCAG CTGTTCTAAT GGTGATCATG TTCGTGTGGC ACTACGTGCA TGTGAAGCGA TACAAGTTTG AGCTTGAACA
TACCGTATCA CCTAATAAGG TCAGAGAGCT CCTTGAACGG CGTGATCTAA AGAGGGTTCC TGGTGTGGGG CTCTTCTACA
CTGAATTGGT GCAAGGCATC CCACCGATAT TCCCTCACCT TATCGAGAAA ATCCCGACCA TTCACTCGGT GATCGTGTTC
ATCTCTATGA AGCACTTGCC TATCCCTCAT GTCGATGTCT CGGAGCGCTT CCTCTTCCGG CAAGTGGAGC CCAAGGAGTG
CATGGTGTTT CGATGTGTCG CACGATATGG ATATCGGGAT ACTCTAGAGA TGGCTGATGA CTTTGTCACC ACTCTTGTCG
AGTACCTCCA GTACTATATC CGGGACCTAA ATCTATACAA CACGGTTGAG CCACTCAAGA TGAGCTGCCC AAGCATTAGA
ATTGATAGTT TTTCCTGGGA TAGACGACCC TCAGGGCATG GCATTTATGC CGAGGAGATG CTTACACCAA TCCAATCATT
TTCTGAGCTC ACAATGCATC CTGTTGGTAT GAGCAGCCGA TTAGCGCAAT TCCAAGTAAG AAATCGATAT ACTAATTAAT
TACCATATAG CTGAACAACA TGTTGAAAAT TATGTATTGT TCTTATATCT GGATGCTAAT AATTTCCTTT TTGTAAATCA
GACAACTAAG ATGAGCCTTG AAGAGATGTT GAAGATTGAG GAAGACCAAA AGTTGATCCA ACGAGAAGTG GACAATGGTG
TGGTTTACAT ACTTGGGGAG AGTGAAGTGG TAGCGAAACC ACATTCCAAC TTGCTTAAGA AAGTTGTTGT AAACTACATA
TTCAACTTTC TGAGGAAAAA CTCTCGAAAA GGAGAGAAGA TGTTGTCTAT TCCACGCCGC AAGTTGCTCA AGGTTGGAAT
CACGTACGAA ATATAAACAT GCCAACAATC AGTAAGATGG TGGCTTATAC ACAAGGGGTG TAGATTTGTC GAGCAAGCAT
ATATCATGCA TGCAGGGTTT GCTTACTTGC AAATGTACTT GGATTTTGTT TGCTTGCGTG ACTCTCCATG ATAGGAAAAA
AAATAAAAGA ATTACATGCA AGGAGGAAAA TATGCCAGCA AAATGAAAAC AGTCATAATC GAGAATATCA CAATGCGATA
TATGGGTTCC ATATATATAG AATTTCTTTT TTC